DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and degt-1

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_505703.3 Gene:degt-1 / 184921 WormBaseID:WBGene00009109 Length:852 Species:Caenorhabditis elegans


Alignment Length:322 Identity:68/322 - (21%)
Similarity:109/322 - (33%) Gaps:93/322 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 TNCTECFKEIYFR----GELVTDCEEIFKFHVTEMGYCFLANNLLDYDSIEEMPLRYSSLDNNRS 200
            |...:|..::|..    .|:..||..|||...|.:              ||...:...:..|:.|
 Worm   581 TEVRDCVTKMYENLERVEEIAEDCRIIFKNRYTPL--------------IEASNVHTKTNPNSES 631

  Fly   201 LRLYMRS--SVMYKYEMY---VNSPE------DLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVI 254
            .:||..:  .|:.|.::.   |...|      ||..|.|....|:.|      :||        |
 Worm   632 FKLYTEAMKKVLAKLQILKTRVRMSEWKDFKIDLKEFESSYREIAKD------HVE--------I 682

  Fly   255 DEPISQRKCKFPSESSIEGFPYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGLQHADCLI 319
            :|.:..||      :.:...|    |..:.:...|...|       ...|..::..|:. ||   
 Worm   683 EEMLKLRK------TMVTDIP----ALANELSETFLAAT-------ESRRKFAVLTGIA-AD--- 726

  Fly   320 KEGFATRVKEYVGSSTVCLPSCVEQQISLVGVITENGT-LYNNNTQITEIQIASP---------- 373
             |.|:.:...:    :.||....|:..:|.......|. |.....|:...|..||          
 Worm   727 -ESFSDKFSNF----SKCLDELHEKAPNLKKTRFIRGEWLSRLRNQVLMAQSYSPTPQYDVVNLL 786

  Fly   374 -----------PTVRYERKVTQTKLDLIVGIGSVAGLFFGASLLNLLEIISYFIKKLKTMIF 424
                       .|:..||  :.....|:..||...||:.||:||...|.:.:..::.|:.||
 Worm   787 HIKFYFAHFKQETILQER--SYNLFLLLAEIGGTIGLYVGATLLTAAETLVFLCERKKSNIF 846

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 65/311 (21%)
degt-1NP_505703.3 ASC 44..>318 CDD:279230
ASC <704..836 CDD:295594 31/149 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.