DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and del-7

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:NP_501276.4 Gene:del-7 / 183498 WormBaseID:WBGene00016699 Length:614 Species:Caenorhabditis elegans


Alignment Length:484 Identity:92/484 - (19%)
Similarity:181/484 - (37%) Gaps:124/484 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MWRKSVMNFRGFIRSFVENKGLLW-IFVIGISGWSTVSILVLLKTRYETDSTTIGVSTAYSRWIN 64
            :|.:.:.....|:.|......:.| |.::..:|||..:.:.:|| :|..::||..::...::.:.
 Worm    63 LWLRELHGLSAFMMSNSLMSKVFWAIVIMACAGWSIGNTISILK-QYGDEATTTLLTILPTKQLK 126

  Fly    65 TFPSIGICLTKSRAFNEFKAMMREYFQEDFAFSFTRM-IYEYA-----FLNPNNIFTKEPTKNTS 123
             ||::..|.......|.:..:...|....:..:.|.. |.:||     |.|.|.     .|.|.:
 Worm   127 -FPTMIFCPRNPDFLNYYNVLEDMYNHLGYMENTTNFHILQYAMTGFGFDNANG-----DTFNET 185

  Fly   124 YPYNFNILDIRRK-----------MFPTN---CTECFKEIYFRGELVTDCEEIFK-FHVTEMGYC 173
            |....:|..::.:           ||..|   ||:.|:..| .|....:|.:||: .:....|.|
 Worm   186 YREQIHIYYLKWRGERTQYEMFDFMFNKNGYTCTDLFQTCY-GGSQTYNCCDIFQPTYAMLRGRC 249

  Fly   174 F-LANNLL--DYDSIEEMPLRYSSL------------------DNNRSL----RLYMRSSVMYKY 213
            | |.::..  |.|.:.::.:.::::                  |:|..:    |.|:.|:...:.
 Worm   250 FRLIDSYYQNDTDEVAKLSIFFNNMTSPILNTGVLPQLVLYNGDSNVEIGIYPRYYLNSNDWNRV 314

  Fly   214 EMYVNSPEDLPFFNSLTYTISTDP------TTYAFNVEEIHNHEGVIDEPISQRKCKFPSESSIE 272
            ..|..|...||..:.    .||||      |.:.:.         .:.:.|.|..|..|.     
 Worm   315 RFYQKSMILLPKSDG----CSTDPIYQGKFTCFVYK---------WLMQLIEQYNCTVPY----- 361

  Fly   273 GFPYSFSACMSIIRSEFEMKTCDCSLFNPKDRNESLYCGLQHADCLIKEGFATRVKEYVGSSTV- 336
               |.::  :|.::   ::..|:..:......|.||                       ..||: 
 Worm   362 ---YKYT--LSYLK---DVPICEPDVIVNNFENISL-----------------------TPSTIG 395

  Fly   337 --CLPSC--VEQQISLVGVI---TENGTLYNNNTQITEIQIASPPTVRYERKVTQTKLDLIVGIG 394
              |..:|  :|..::|...|   .:...::......|.::..     :|:...|.:....|..:|
 Worm   396 YKCTSACSRIENTVTLATSIDTDPDPSYMFRIEASFTYLEYE-----QYKEIRTTSTAGFISELG 455

  Fly   395 SVAGLFFGASLLNLLEII-SYFIKKLKTM 422
            ..||||.|:|:::.:::. |.||:..|.:
 Worm   456 GQAGLFVGSSVMSFVQLFNSVFIQIYKIL 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 62/346 (18%)
del-7NP_501276.4 ASC <434..473 CDD:295594 10/43 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162376
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.