DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and Asic2

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_006532059.1 Gene:Asic2 / 11418 MGIID:1100867 Length:596 Species:Mus musculus


Alignment Length:295 Identity:59/295 - (20%)
Similarity:116/295 - (39%) Gaps:65/295 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   168 TEMGYCFLANN---------------------LLDYDSIEEMPLRYSSLDNNRSLRLYMRSSVMY 211
            |:.|.|::.|:                     :||....|.:|:...:.:..      ..:.|  
Mouse   272 TKYGKCYMFNSGEDGKPLLTTVKGGTGNGLEIMLDIQQDEYLPIWGETEETT------FEAGV-- 328

  Fly   212 KYEMYVNSPEDLPFFNSLTYTISTDPTTYAFNVEEIHNHEGVIDEPISQRKCKFPSESSIEGFP- 275
              ::.::|..:.||...|.:.::....|:....|:...:     .|....:|: .||..::.|| 
Mouse   329 --KVQIHSQSEPPFIQELGFGVAPGFQTFVATQEQRLTY-----LPPPWGECR-SSEMGLDFFPV 385

  Fly   276 YSFSACMSIIRSEFEMKTCDCSLFN-PKDRNESLYC-GLQHADC------LIKEGFATRVKEYVG 332
            ||.:||.....:.:.::.|:|.:.: |.|   :.:| ..||.:|      |:.|    :...|..
Mouse   386 YSITACRIDCETRYIVENCNCRMVHMPGD---APFCTPEQHKECAEPALGLLAE----KDSNYCL 443

  Fly   333 SSTVCLPSCVEQQISLVGVITENGTLY------------NNNTQITEIQIASPPTVRYERKVTQT 385
            ..|.|..:...:::|:|.:.::....|            :.|..:.:|...:......|:|....
Mouse   444 CRTPCNLTRYNKELSMVKIPSKTSAKYLEKKFNKSEKYISENILVLDIFFEALNYETIEQKKAYE 508

  Fly   386 KLDLIVGIGSVAGLFFGASLLNLLEIISYFIKKLK 420
            ...|:..||...|||.|||:|.:||:..|..:.:|
Mouse   509 VAALLGDIGGQMGLFIGASILTILELFDYIYELIK 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 57/288 (20%)
Asic2XP_006532059.1 ASC 64..590 CDD:383197 59/295 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167842230
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11690
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.