DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ppk29 and scnn1d

DIOPT Version :9

Sequence 1:NP_001097442.2 Gene:ppk29 / 37844 FlyBaseID:FBgn0034965 Length:425 Species:Drosophila melanogaster
Sequence 2:XP_031762206.1 Gene:scnn1d / 100496702 XenbaseID:XB-GENE-991876 Length:604 Species:Xenopus tropicalis


Alignment Length:500 Identity:93/500 - (18%)
Similarity:165/500 - (33%) Gaps:159/500 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 YETDSTTIGVSTAYSRWINTFPSIGICLTKSRAFNEFKAMMREYFQEDFAFSFTRMIYEYAFLNP 110
            |.| :|.||:.:..    ..||::.||......|::....:.:.  :..|.....::|||.:..|
 Frog    76 YPT-NTIIGLQSKG----KIFPAVTICNLNPYRFDQVNMYINQL--DQLAKETLYLLYEYEYEVP 133

  Fly   111 NN----IFTKEPTKNTSYPYNFN-ILDIR-----------------RKMFPTN---CT---ECFK 147
            .:    :..::...|.:..:|.| |||..                 :|.|...   |.   :|:.
 Frog   134 ESPQQVVDLQDLLNNVTGQFNGNFILDQSIVLQKLQENGSGPALPGQKKFKVGFKLCNSSGDCYY 198

  Fly   148 EIYFRG----------------------------------------ELVTDCEEIFKFHVTEMGY 172
            :.::.|                                        |:..|..|...||....|.
 Frog   199 KWFWSGFDAVHEWYKFHYINIMSNIPAVLNIANNFSRDYILTCHFNEMPCDEREYVHFHHPIYGN 263

  Fly   173 CFLANNLLDYDSIEEMPLRYSSLDNNRSLRLYMRSSVMYKYEMYVNSPEDLPFFNSLTYTISTDP 237
            ||..||....:|      .|||    |..:.| ..|::.|.:::.|.|       .|:.......
 Frog   264 CFTINNHWKENS------WYSS----RPGKQY-GLSIVVKTDLHDNMP-------LLSQAAGARI 310

  Fly   238 TTYAFNVEEIHNHEGVIDEPISQRKCKFPSESSIE---------------------GFPYSFSAC 281
            ..:..|...:..|:|....|.::.......|.:|.                     ...|:..||
 Frog   311 MIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDLGIKILYNTSYTMQAC 375

  Fly   282 MSIIRSEFEMK---TCDCS-LFNPKDRNESLYCGL-QHAD---CLIKEGFATRVKEYVGSSTVCL 338
            ::   |.|:.|   .|.|. .|.|...... ||.. :|.|   |     |....::.:..:.:|.
 Frog   376 LN---SCFQYKMIEVCGCGYYFYPLPPGME-YCNYNKHPDWGYC-----FYQLYEKMLDHTLICF 431

  Fly   339 PSCVEQ-----------------QISLVGVITENGTLYNNNTQITEIQIASPPTVRYE----RKV 382
            ..|.:|                 .:|....:......||:.::.::|   |...|.||    |.|
 Frog   432 TQCPKQCKQTEYHLSAGTAKWPSPVSKAKKLLSLQERYNSTSKRSDI---SKINVYYEELSYRSV 493

  Fly   383 TQT-KLDLIVGIGSVAGL---FFGASLLNLLEIISYFIKKLKTMI 423
            .:| .:.:.:.:.|:.||   :||:|:|::.||....:..:..:|
 Frog   494 EETPSVSVTMLLSSMGGLWSWWFGSSVLSVAEIAELVLDTVAMVI 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ppk29NP_001097442.2 ASC 123..415 CDD:279230 76/409 (19%)
scnn1dXP_031762206.1 ENaC 18..583 CDD:273304 92/499 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D303969at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.