DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sei and kcnh6b

DIOPT Version :9

Sequence 1:NP_001286814.1 Gene:sei / 37843 FlyBaseID:FBgn0003353 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_021328182.1 Gene:kcnh6b / 570070 ZFINID:ZDB-GENE-121214-55 Length:893 Species:Danio rerio


Alignment Length:542 Identity:337/542 - (62%)
Similarity:421/542 - (77%) Gaps:14/542 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 LLGSKSEPKGQDPNDMIT---SLGGNILLDQKLQNNYYHKWTLLHYSPFKAVWDWIILILVMYTA 335
            |:..|.:.:.|:..:.:|   |||.::|.:.|||....|||.:||||||||:|||:||:||:|||
Zfish    52 LVTPKVKERTQNVTEKVTQVLSLGADVLPEYKLQAPDVHKWIMLHYSPFKAIWDWVILLLVLYTA 116

  Fly   336 IFTPYVAAFLLGEQDYQRRNSKYINSDPIVIIDLIVDVTFIVDIIINFRTTFVNSQDEVVSHPGR 400
            :|||:.|||||.|.:.:||.:.....:|:.::|:||||.||.||:|.||||:||..||||:||.|
Zfish   117 VFTPFSAAFLLNELEDERRQTCGYTCNPLNVVDVIVDVLFIADIVITFRTTYVNHNDEVVTHPKR 181

  Fly   401 IAVHYLSGWFLIDLVAAVPFDLLLVGSDTDETT-TLIGLLKTARLLRLVRVARKIDRYSEYGAAV 464
            ||:||:.|||.||:|||:|||||:..|.:|||| ||||||||||||||||||||:||||||||||
Zfish   182 IAIHYIKGWFFIDMVAAIPFDLLIFRSGSDETTATLIGLLKTARLLRLVRVARKLDRYSEYGAAV 246

  Fly   465 LILLMATFILIAHWLACIWYAIGNAEKSIASKNIGWLNSLAYDIQEPYFD-NRTGGPSIKSRYIT 528
            |.|||.||.||||||||||||||:.|:..  ...|||::||..:.:.|.| :.:.||||:.:|||
Zfish   247 LFLLMCTFGLIAHWLACIWYAIGHVERPY--MKTGWLDNLADQLGKRYNDSDASSGPSIQDKYIT 309

  Fly   529 ALYFTFTSLTSVGFGNVAPNTDAEKAFTICVMLVGSLMYASIFGNVSAIIQRLYSGTARYHTQML 593
            ||||||:||||||||||:|||::||.|:||||.:|||||||||||||||||||||||.|||||||
Zfish   310 ALYFTFSSLTSVGFGNVSPNTNSEKMFSICVMFIGSLMYASIFGNVSAIIQRLYSGTTRYHTQML 374

  Fly   594 RVREFIRFHQIPNPLRQRLEEYFQHAWTYTNGIDMNSLLKGFPECLQADICLHLNRKLLTTCAAF 658
            ||:|||||||||..|||||||||||||:||||||||::||||||||||||||||||.||..|..|
Zfish   375 RVKEFIRFHQIPGGLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLNRSLLQNCKVF 439

  Fly   659 SEASPGCLRAFSLKFKTTHAPPGDILVHRGDVLTSLYFIARGSIEIQRAGNIV--VLGKNDIFGE 721
            ..||..||||.:::|::||:||||.|.|:||:|.:|:||:||||::.: .|||  :|||||:|||
Zfish   440 RGASKACLRALAVRFRSTHSPPGDALYHQGDMLRALHFISRGSIQVSQ-HNIVLAILGKNDVFGE 503

  Fly   722 NPCIYPTVGKSNGVVRALTYCDIHKLHRDDLLDVLDSYPEFLESFVSNLVITYNMRDDEH----S 782
            ...:|...|.||..|.||||||:|::.|||||:|||.||.|.|||..||.||:|:||.|.    .
Zfish   504 PVNLYAEPGHSNADVTALTYCDLHRIRRDDLLEVLDMYPAFGESFWRNLEITFNLRDVEQMMPSE 568

  Fly   783 GVDIKHRYLRAKSSDKMRSSPD 804
            .::..::....::....|:.||
Zfish   569 SLECSYQARHRQNLLDRRNRPD 590

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seiNP_001286814.1 Ion_trans 360..583 CDD:278921 156/224 (70%)
Ion_trans_2 <526..580 CDD:285168 45/53 (85%)
CAP_ED 657..767 CDD:237999 62/111 (56%)
Crp 666..>766 CDD:223736 57/101 (56%)
kcnh6bXP_021328182.1 Ion_trans 103..364 CDD:306908 177/262 (68%)
CAP_ED 438..549 CDD:237999 62/111 (56%)
PAT1 <681..>831 CDD:330585
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 381 1.000 Domainoid score I794
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.