DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sei and Cngl

DIOPT Version :9

Sequence 1:NP_001286814.1 Gene:sei / 37843 FlyBaseID:FBgn0003353 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001245691.1 Gene:Cngl / 32468 FlyBaseID:FBgn0263257 Length:1970 Species:Drosophila melanogaster


Alignment Length:475 Identity:123/475 - (25%)
Similarity:221/475 - (46%) Gaps:64/475 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 NYYHKWTLLHYSPFKAVWDWIILILVMYTAIFTPYVAAFLLGEQDYQRRNSKYINSDPI--VIID 368
            |:|..|.::            :.:.|:|. ::|      |:..|.:....    .|.|.  :|.|
  Fly   240 NFYFYWLMM------------LTVCVLYN-LWT------LIVRQSFPELQ----QSVPTFWLICD 281

  Fly   369 LIVDVTFIVDIIINFRTTFVNSQDEVVSHPGRIAVHYL-SGWFLIDLVAAVPFDLLLVGSDTDET 432
            .:.||.||:|||:..||.:: .|..:|....::|.||: |..|:.|::|.:|.|||.:...|.. 
  Fly   282 SMTDVVFILDIIVQLRTGYL-EQGLMVYDDRKLACHYVHSRDFIFDMIALIPLDLLQLKMGTHP- 344

  Fly   433 TTLIGLLKTARLLRLVRVARKIDRYSEYGAAV------LILLMATFILIAHWLACIWYAIGNAEK 491
                 ||:..|..::.|..|..  |......|      ::.|:...:::|||..|.::.:..|| 
  Fly   345 -----LLRFTRFFKVYRSVRFY--YIVESRTVWPNLWRVVNLIHILLILAHWFGCFYFLLSEAE- 401

  Fly   492 SIASKNIGWLNSLAYDIQEPYFDNRTGG-PSIKSRYITALYFTFTSLTSVGFGNVAPNTDAEKAF 555
                   |:.....|    ||   |.|. .::..:|:.:||::..:||::| ....|.|:||..|
  Fly   402 -------GFQGDWVY----PY---RPGDYATLTRKYLGSLYWSTLTLTTIG-DLPTPETNAEYIF 451

  Fly   556 TICVMLVGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAW 620
            ||...|:|..::|:|.|.|..:|....:....:...:...:.::|.|::|..:::|:..::.::|
  Fly   452 TIVSYLIGVFIFATIVGQVGNVITNRNANRLEFERLLDGAKTYMRHHKVPGGMKRRVLRWYDYSW 516

  Fly   621 T---YTNGIDMNSLLKGFPECLQADICLHLNRKLLTTCAAFSEASPGCLRAFSLKFKTTHAPPGD 682
            :   ...|.|:|:.|...|:.|:.::.||:|..:|.....|.|..|..|....||.|.....|||
  Fly   517 SRGRIQGGGDINTALGLLPDKLKTELALHVNLSVLKKVTIFQECQPEFLHDLVLKMKAYIFTPGD 581

  Fly   683 ILVHRGDVLTSLYFIARGSIEI-QRAGNIVVLGK-NDIFGENPCI-YPTVGKSNGVVRALTYCDI 744
            .:..:|:|...::.||.|.:|: ...|.::...| .|.|||...: ...:.|....||::.|.::
  Fly   582 SICRKGEVAREMFIIADGILEVLSETGKVLTTMKAGDFFGEIGILNLDGLNKRTADVRSVGYSEL 646

  Fly   745 HKLHRDDLLDVLDSYPEFLE 764
            ..|.|:|:|..:..||:..|
  Fly   647 FSLSREDVLAAMKDYPDAQE 666

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seiNP_001286814.1 Ion_trans 360..583 CDD:278921 67/232 (29%)
Ion_trans_2 <526..580 CDD:285168 20/53 (38%)
CAP_ED 657..767 CDD:237999 33/111 (30%)
Crp 666..>766 CDD:223736 30/102 (29%)
CnglNP_001245691.1 Ion_trans 260..481 CDD:278921 69/249 (28%)
Ion_trans_2 382..476 CDD:285168 32/109 (29%)
Crp 550..>680 CDD:223736 34/117 (29%)
CAP_ED 556..668 CDD:237999 33/111 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45445390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.