DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sei and KCNH3

DIOPT Version :9

Sequence 1:NP_001286814.1 Gene:sei / 37843 FlyBaseID:FBgn0003353 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_011536387.1 Gene:KCNH3 / 23416 HGNCID:6252 Length:1094 Species:Homo sapiens


Alignment Length:548 Identity:226/548 - (41%)
Similarity:315/548 - (57%) Gaps:74/548 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   278 KSEPK----------GQDPNDMITSLGGNILLDQKLQNNYYHKWTLLHYSPFKAVWDWIILILVM 332
            :.:||          |:.||          |.:.|:.......:.|||....:|.||..||:..:
Human   182 QKQPKGKHKLNKGVFGEKPN----------LPEYKVAAIRKSPFILLHCGALRATWDGFILLATL 236

  Fly   333 YTAIFTPYVAAFLLGEQDYQRRNSKYINSDPIVIIDLIVDVTFIVDIIINFRTTFVNSQDEVVSH 397
            |.|:..||........:....|.       |..:.||.|:|.||:||::|||||||:...:||..
Human   237 YVAVTVPYSVCVSTAREPSAARG-------PPSVCDLAVEVLFILDIVLNFRTTFVSKSGQVVFA 294

  Fly   398 PGRIAVHYLSGWFLIDLVAAVPFDLLLVGSDTDETTTLIG--LLKTARLLRLVRVARKIDRYSEY 460
            |..|.:||::.|||:|::||:|||||    ...:.....|  ||||.|||||:|:..::||||:|
Human   295 PKSICLHYVTTWFLLDVIAALPFDLL----HAFKVNVYFGAHLLKTVRLLRLLRLLPRLDRYSQY 355

  Fly   461 GAAVLILLMATFILIAHWLACIWYAIGNAE-KSIASK--NIGWLNSLAYDIQEPYF--------- 513
            .|.||.||||.|.|:|||:||:|:.||..| :|..|:  .||||..||..::.||:         
Human   356 SAVVLTLLMAVFALLAHWVACVWFYIGQREIESSESELPEIGWLQELARRLETPYYLVGRRPAGG 420

  Fly   514 ------DNRT-------------GGPSIKSRYITALYFTFTSLTSVGFGNVAPNTDAEKAFTICV 559
                  ||.:             ||||::|.|||:|||..:||||||||||:.|||.||.|:||.
Human   421 NSSGQSDNCSSSSEANGTGLELLGGPSLRSAYITSLYFALSSLTSVGFGNVSANTDTEKIFSICT 485

  Fly   560 MLVGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRFHQIPNPLRQRLEEYFQHAWTYTN 624
            ||:|:||:|.:||||:|||||:|:....||::...:|::||.|:||.||:||:.||||..|...|
Human   486 MLIGALMHAVVFGNVTAIIQRMYARRFLYHSRTRDLRDYIRIHRIPKPLKQRMLEYFQATWAVNN 550

  Fly   625 GIDMNSLLKGFPECLQADICLHLNRKLLTTCAAFSEASPGCLRAFSLKFKTTHAPPGDILVHRGD 689
            |||...||:..|:.|:|||.:||::::| ....|..||.|||||.||..:.....||:.|:|:||
Human   551 GIDTTELLQSLPDELRADIAMHLHKEVL-QLPLFEAASRGCLRALSLALRPAFCTPGEYLIHQGD 614

  Fly   690 VLTSLYFIARGSIEIQRAGNIV-VLGKNDIFGENPCIYP---TVGKSNGVVRALTYCDIHKLHRD 750
            .|.:|||:..||:|:.:.|.:: :|||.|:.|   |..|   .|.|:|..|:.||||.:..|...
Human   615 ALQALYFVCSGSMEVLKGGTVLAILGKGDLIG---CELPRREQVVKANADVKGLTYCVLQCLQLA 676

  Fly   751 DLLDVLDSYPEFLESFVSNL--VITYNM 776
            .|.|.|..||||...|...|  .::||:
Human   677 GLHDSLALYPEFAPRFSRGLRGELSYNL 704

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seiNP_001286814.1 Ion_trans 360..583 CDD:278921 123/255 (48%)
Ion_trans_2 <526..580 CDD:285168 37/53 (70%)
CAP_ED 657..767 CDD:237999 47/113 (42%)
Crp 666..>766 CDD:223736 42/103 (41%)
KCNH3XP_011536387.1 PAS 42..133 CDD:238075
PAS_3 42..123 CDD:285623
Ion_trans 246..511 CDD:278921 125/275 (45%)
Ion_trans_2 <452..506 CDD:285168 37/53 (70%)
CAP_ED 582..692 CDD:237999 47/112 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145039
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X71
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.