DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sei and KCNH4

DIOPT Version :9

Sequence 1:NP_001286814.1 Gene:sei / 37843 FlyBaseID:FBgn0003353 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_036417.1 Gene:KCNH4 / 23415 HGNCID:6253 Length:1017 Species:Homo sapiens


Alignment Length:553 Identity:247/553 - (44%)
Similarity:347/553 - (62%) Gaps:50/553 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   280 EPKGQDPNDMITSLGGNILLDQKLQNNYYHKWTLLHYSPFKAVWDWIILILVMYTAIFTPYVAAF 344
            |||...|...:.|:||:..|             |||||..||:||.:||:...|.|:..||...|
Human   199 EPKPSVPEYKVASVGGSRCL-------------LLHYSVSKAIWDGLILLATFYVAVTVPYNVCF 250

  Fly   345 LLGEQDYQRRNSKYINSDPIVIIDLIVDVTFIVDIIINFRTTFVNSQDEVVSHPGRIAVHYLSGW 409
             .|:.|..      |.|...::.|:.|::.||:|||:|||||:|:...:|:|.|..|.:|||:.|
Human   251 -SGDDDTP------ITSRHTLVSDIAVEMLFILDIILNFRTTYVSQSGQVISAPRSIGLHYLATW 308

  Fly   410 FLIDLVAAVPFDLLLVGSDTDETTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLILLMATFIL 474
            |.|||:||:|||||.:.:.|  .|:|:.||||.|||||:|:.:|::|||:..|.||.|||:.|.|
Human   309 FFIDLIAALPFDLLYIFNIT--VTSLVHLLKTVRLLRLLRLLQKLERYSQCSAVVLTLLMSVFAL 371

  Fly   475 IAHWLACIWYAIGNAEKSIASK---NIGWLNSLAYDIQEPYFDNRTGGPSIKSRYITALYFTFTS 536
            :|||:|||||.||..|......   :||||:.|...::.||.:...||||.:|.||.|||||.:|
Human   372 LAHWMACIWYVIGRREMEANDPLLWDIGWLHELGKRLEVPYVNGSVGGPSRRSAYIAALYFTLSS 436

  Fly   537 LTSVGFGNVAPNTDAEKAFTICVMLVGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVREFIRF 601
            |||||||||..||||||.|:||.||:|:||:|.:||||:|||||:||..:.||::|..:::|||.
Human   437 LTSVGFGNVCANTDAEKIFSICTMLIGALMHAVVFGNVTAIIQRMYSRRSLYHSRMKDLKDFIRV 501

  Fly   602 HQIPNPLRQRLEEYFQHAWTYTNGIDMNSLLKGFPECLQADICLHLNRKLLTTCAAFSEASPGCL 666
            |::|.||:||:.||||..|...:|||.|.||:.||:.|:|||.:||||::| ....|..||.|||
Human   502 HRLPRPLKQRMLEYFQTTWAVNSGIDANELLRDFPDELRADIAMHLNREIL-QLPLFGAASRGCL 565

  Fly   667 RAFSLKFKTTHAPPGDILVHRGDVLTSLYFIARGSIEIQRAGNIV-VLGKNDIFGEN---PCIYP 727
            ||.||..||:...||:.|:.|||.|.:.|::..||:|:.|...:: :|||.|:.|.:   |...|
Human   566 RALSLHIKTSFCAPGEYLLRRGDALQAHYYVCSGSLEVLRDNMVLAILGKGDLIGADIPEPGQEP 630

  Fly   728 TVG-------KSNGVVRALTYCDIHKLHRDDLLDVLDSYPEFLESFVSNLV--ITYNMRD-DEHS 782
            .:|       |::..|:|||||.:.:|....|.:||..|||:..:|.:.|.  :|:|:|. .:.|
Human   631 GLGADPNFVLKTSADVKALTYCGLQQLSSRGLAEVLRLYPEYGAAFRAGLPRDLTFNLRQGSDTS 695

  Fly   783 GVDIKHRYLRA-----KSSDKMRSSPD--IPSI 808
            |:.   |:.|:     ..|:.:.||.|  :|||
Human   696 GLS---RFSRSPRLSQPRSESLGSSSDKTLPSI 725

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seiNP_001286814.1 Ion_trans 360..583 CDD:278921 122/225 (54%)
Ion_trans_2 <526..580 CDD:285168 39/53 (74%)
CAP_ED 657..767 CDD:237999 46/120 (38%)
Crp 666..>766 CDD:223736 41/110 (37%)
KCNH4NP_036417.1 PAS_9 29..135 CDD:290162
PAS 29..133 CDD:238075
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..157
Ion_trans 244..486 CDD:278921 130/250 (52%)
Ion_trans_2 <426..480 CDD:285168 39/53 (74%)
Selectivity filter. /evidence=ECO:0000250 439..444 4/4 (100%)
CAP_ED 556..676 CDD:237999 46/119 (39%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..749 11/38 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 772..803
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 821..875
PHA02682 838..>999 CDD:177464
bZIP <872..901 CDD:304365
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 971..1017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165145040
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0498
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000148
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X71
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.740

Return to query results.
Submit another query.