DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment sei and hcn5

DIOPT Version :9

Sequence 1:NP_001286814.1 Gene:sei / 37843 FlyBaseID:FBgn0003353 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_017213269.1 Gene:hcn5 / 101884258 ZFINID:ZDB-GENE-081105-169 Length:305 Species:Danio rerio


Alignment Length:276 Identity:62/276 - (22%)
Similarity:109/276 - (39%) Gaps:66/276 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   313 LLHYSPFKAVWDWIILILVMYT---AIFTPYVAAFLLGEQDYQRRNSKYINSDPIVIIDLIVDVT 374
            ::|  ||..:..:.|:.:|..|   .|..|...|||.|........           .::..|..
Zfish    53 VIH--PFSRLRSYYIMCMVAITFLNLIGIPMEIAFLDGNSGVGWEG-----------FNVFSDTL 104

  Fly   375 FIVDIIINFRTTFVNSQ-DEVVSHPGRIAVHYLSGWFLIDLVAAVPFDLLLVGSD----TDETTT 434
            |::|:.:|||...:... :..:.....|...||..||:.|||||.|...:|:.:|    :|..::
Zfish   105 FLIDVGVNFRMGIIPEDCERAILDLKSIRHRYLKSWFIPDLVAAFPVGYILLIADLQYHSDSPSS 169

  Fly   435 -------------LIGLLKTARLLRLVRVARKIDRYSEYGAAV-------LILLMATFILIAHWL 479
                         :|.|::..|:.||||...:::|.|.....|       |.|.|..| |:.||.
Zfish   170 KASKMMRILMFVRIISLVRLLRVSRLVRFFNEVERVSNANLEVVRVFLKILSLFMMIF-LLCHWN 233

  Fly   480 ACIWYAIGNAEKS-----IASKNIGWLNSLAYDIQEPYFDNRTGGPSIKSRYITALYFTFTSLTS 539
            .||.|.:...|:.     :..:|:  :|:                 |:..:|...::...:.:|:
Zfish   234 GCIQYFVPMLEEFPSDCWVRRENL--MNA-----------------SVGEKYSFGVFRALSHMTA 279

  Fly   540 VGFGNVAPNTDAEKAF 555
            :.:|:....|..|..|
Zfish   280 ISYGSSETPTSKEYTF 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
seiNP_001286814.1 Ion_trans 360..583 CDD:278921 50/226 (22%)
Ion_trans_2 <526..580 CDD:285168 6/30 (20%)
CAP_ED 657..767 CDD:237999
Crp 666..>766 CDD:223736
hcn5XP_017213269.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.