DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment gammaSnap1 and Y59A8B.25

DIOPT Version :9

Sequence 1:NP_477469.1 Gene:gammaSnap1 / 37842 FlyBaseID:FBgn0028552 Length:302 Species:Drosophila melanogaster
Sequence 2:NP_001041199.1 Gene:Y59A8B.25 / 4363109 WormBaseID:WBGene00044794 Length:145 Species:Caenorhabditis elegans


Alignment Length:152 Identity:42/152 - (27%)
Similarity:74/152 - (48%) Gaps:13/152 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 AAEYASKVSRILVKLRRYDEATNALKKEISLNQQTESYGQIGRLVVALVMVQLARGDSVEAEKTF 220
            |:.:..:::::.::|..|..|..::::||....:...|.:||:|.:.||:|.||..|||.|.|.:
 Worm     2 ASNFLKQITKLSLQLTDYKGALGSIREEIEKFAEIREYPRIGQLGIGLVIVNLALEDSVAALKDY 66

  Fly   221 REWGNCCEP-----EEVSTLQTLLQAFDDEDPELAARMLASPFIRHMDVEYAILSKNIPLPQGIQ 280
             .|..|..|     |:....:.|:..::..|.|....:|....:|.||.||..:.|.:..|.|  
 Worm    67 -GWVICQSPDFQTSEDGRVCENLIGFYEAGDDESFQNVLKCGALRSMDNEYLRVMKILKAPSG-- 128

  Fly   281 MEKKAGDTAAETNDAEDEGGLC 302
               .||  ..:..:.:|:.|||
 Worm   129 ---NAG--LGDGQEDDDDEGLC 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
gammaSnap1NP_477469.1 SNAP 11..248 CDD:305195 26/96 (27%)
TPR repeat 33..70 CDD:276937
TPR repeat 74..111 CDD:276937
TPR repeat 114..149 CDD:276937
TPR repeat 153..187 CDD:276937 6/30 (20%)
Y59A8B.25NP_001041199.1 SNAP <50..122 CDD:305195 22/72 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166911
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1585
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H2838
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1540214at2759
OrthoFinder 1 1.000 - - FOG0003744
OrthoInspector 1 1.000 - - mtm4851
orthoMCL 1 0.900 - - OOG6_103437
Panther 1 1.100 - - LDO PTHR13768
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.750

Return to query results.
Submit another query.