DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and COF1

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_013050.1 Gene:COF1 / 850676 SGDID:S000003973 Length:143 Species:Saccharomyces cerevisiae


Alignment Length:140 Identity:52/140 - (37%)
Similarity:81/140 - (57%) Gaps:7/140 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYDQFLEDIQKCGPGECRYG 67
            |||.|:|...|.:.::|..||:::::|.:.|.|...|......:..||.|||   |....:|.|.
Yeast     4 SGVAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKETSTDPSYDAFLE---KLPENDCLYA 65

  Fly    68 LFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSE 132
            ::||||    :......|:.|:...:|.||||.|:.||:|:||.|||:::|.||...:|.||.||
Yeast    66 IYDFEY----EINGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTDFSE 126

  Fly   133 ASREAVEEKL 142
            .|.::|.|::
Yeast   127 VSYDSVLERV 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 52/138 (38%)
COF1NP_013050.1 ADF_cofilin_like 4..136 CDD:200442 52/138 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157346769
Domainoid 1 1.000 92 1.000 Domainoid score I1714
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 100 1.000 Inparanoid score I1453
Isobase 1 0.950 - 0 Normalized mean entropy S1466
OMA 1 1.010 - - QHG53544
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - otm46802
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - LDO PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
TreeFam 00.000 Not matched by this tool.
1413.780

Return to query results.
Submit another query.