DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF11

DIOPT Version :10

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001320442.1 Gene:ADF11 / 839281 AraportID:AT1G01750 Length:145 Species:Arabidopsis thaliana


Alignment Length:143 Identity:53/143 - (37%)
Similarity:90/143 - (62%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEK--QIDVETVADRNAEYDQFLEDIQKCGPGEC 64
            |||:.|||.||..:.|:|..:.:|:::|.| |||  |:.::.:.:....|:.|...|.:   .||
plant    10 ASGMHVSDECKLKFLELKAKRNYRFIVFKI-DEKAQQVMIDKLGNPEETYEDFTRSIPE---DEC 70

  Fly    65 RYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATD 129
            ||.::|:::.     |.|:.:|.|:|.::|.|||::|:.||||:||.|..|:.|.|:|..:||||
plant    71 RYAVYDYDFT-----TPENCQKSKIFFIAWSPDTSRVRSKMLYASSKDRFKRELDGIQVELQATD 130

  Fly   130 LSEASREAVEEKL 142
            .||.|.:.::.::
plant   131 PSEMSLDIIKGRV 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 52/140 (37%)
ADF11NP_001320442.1 ADF_gelsolin 9..142 CDD:472830 53/140 (38%)

Return to query results.
Submit another query.