DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF4

DIOPT Version :10

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_851228.1 Gene:ADF4 / 836111 AraportID:AT5G59890 Length:139 Species:Arabidopsis thaliana


Alignment Length:142 Identity:52/142 - (36%)
Similarity:89/142 - (62%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRD-EKQIDVETVADRNAEYDQFLEDIQKCGPGECR 65
            |||:.|.|.||..:.|:|..:.||::::.|.: :||:.||.|.:....|:.|...:.   ..|||
plant     5 ASGMAVHDDCKLRFLELKAKRTHRFIVYKIEEKQKQVIVEKVGEPILTYEDFAASLP---ADECR 66

  Fly    66 YGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDL 130
            |.::||:::     |:|:.:|.|:|.::||||.|||:.||:|:||.|..|:.|.|:|..:||||.
plant    67 YAIYDFDFV-----TAENCQKSKIFFIAWCPDVAKVRSKMIYASSKDRFKRELDGIQVELQATDP 126

  Fly   131 SEASREAVEEKL 142
            :|...:.::.::
plant   127 TEMDLDVLKSRV 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 51/139 (37%)
ADF4NP_851228.1 ADF_cofilin_like 6..138 CDD:200442 51/139 (37%)

Return to query results.
Submit another query.