DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF3

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_851227.1 Gene:ADF3 / 836110 AraportID:AT5G59880 Length:139 Species:Arabidopsis thaliana


Alignment Length:142 Identity:53/142 - (37%)
Similarity:86/142 - (60%) Gaps:11/142 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRD-EKQIDVETVADRNAEYDQFLEDIQKCGPG-EC 64
            |||:.|.|.||..:.|:|..:.||::|:.|.: :||:.||.:    .|..|..||:....|. ||
plant     5 ASGMAVHDDCKLKFMELKTKRTHRFIIYKIEELQKQVIVEKI----GEPGQTHEDLAASLPADEC 65

  Fly    65 RYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATD 129
            ||.:|||:::     :||...:.::|.::|.||||:|:.||:|:||.|..|:.|.|:|..:||||
plant    66 RYAIFDFDFV-----SSEGVPRSRIFFVAWSPDTARVRSKMIYASSKDRFKRELDGIQVELQATD 125

  Fly   130 LSEASREAVEEK 141
            .:|...:..:.:
plant   126 PTEMDLDVFKSR 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 52/141 (37%)
ADF3NP_851227.1 ADF_cofilin_like 6..138 CDD:200442 52/141 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2370
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2088
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm1086
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.