DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF10

DIOPT Version :10

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_568769.1 Gene:ADF10 / 835312 AraportID:AT5G52360 Length:137 Species:Arabidopsis thaliana


Alignment Length:140 Identity:53/140 - (37%)
Similarity:87/140 - (62%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNAEYDQFLEDIQKCGPGECRY 66
            |||:.|.|.||..:.|:|..:.:|::||.| |.:|:.||.:......||.|...:.   |.||||
plant     5 ASGMAVEDECKLKFLELKAKRNYRFIIFRI-DGQQVVVEKLGSPQENYDDFTNYLP---PNECRY 65

  Fly    67 GLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLS 131
            .::||::.     |:|:.:|.|:|.::|.||:::|:.||:|:||.|..|:.|.|:|..:||||.|
plant    66 AVYDFDFT-----TAENIQKSKIFFIAWSPDSSRVRMKMVYASSKDRFKRELDGIQVELQATDPS 125

  Fly   132 EASREAVEEK 141
            |.|.:.::.:
plant   126 EMSLDIIKSR 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 52/139 (37%)
ADF10NP_568769.1 ADF_cofilin_like 6..136 CDD:200442 52/139 (37%)

Return to query results.
Submit another query.