DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF9

DIOPT Version :10

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_195223.2 Gene:ADF9 / 829649 AraportID:AT4G34970 Length:141 Species:Arabidopsis thaliana


Alignment Length:142 Identity:41/142 - (28%)
Similarity:87/142 - (61%) Gaps:9/142 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDE-KQIDVETVADRNAEYDQFLEDIQKCGPGECRY 66
            ||:.::|.||.::.|:|..|.||||::.:.:: :::.|:.|......||.....:.:   .:|||
plant     8 SGMWMTDDCKKSFMEMKWKKVHRYVVYKLEEKSRKVTVDKVGAAGESYDDLAASLPE---DDCRY 69

  Fly    67 GLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLS 131
            .:|||:|:     |.::.:..|:|.::|.|:.:::::||:|::|...|::.|.||...:||||.:
plant    70 AVFDFDYV-----TVDNCRMSKIFFITWSPEASRIREKMMYATSKSGLRRVLDGVHYELQATDPT 129

  Fly   132 EASREAVEEKLR 143
            |...:.::::.:
plant   130 EMGFDKIQDRAK 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 41/139 (29%)
ADF9NP_195223.2 ADF_gelsolin 1..141 CDD:472830 41/140 (29%)

Return to query results.
Submit another query.