DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and AT3G45990

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_190185.1 Gene:AT3G45990 / 823742 AraportID:AT3G45990 Length:133 Species:Arabidopsis thaliana


Alignment Length:144 Identity:44/144 - (30%)
Similarity:78/144 - (54%) Gaps:18/144 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVE------TVADRNAEYDQFLEDIQKCGPGE 63
            :.:.|.||.|:.|:|:.:..|.:::.|.|..|:.||      ...:|...|::|...:.   ..|
plant     1 MVLHDDCKLTFLELKERRTFRSIVYKIEDNMQVIVEKHHYKKMHGEREQSYEEFANSLP---ADE 62

  Fly    64 CRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQAT 128
            |||.:.|.|::         ..::|:..::|.|.|||::|||:|||:.|..|:.|.|:|....||
plant    63 CRYAILDIEFV---------PGERKICFIAWSPSTAKMRKKMIYSSTKDRFKRELDGIQVEFHAT 118

  Fly   129 DLSEASREAVEEKL 142
            ||::.|.:|:..::
plant   119 DLTDISLDAIRRRI 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 44/142 (31%)
AT3G45990NP_190185.1 ADF_cofilin_like 3..132 CDD:200442 44/140 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 99 1.000 Domainoid score I2370
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I2088
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm1086
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.940

Return to query results.
Submit another query.