DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF6

DIOPT Version :10

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_565719.1 Gene:ADF6 / 817676 AraportID:AT2G31200 Length:146 Species:Arabidopsis thaliana


Alignment Length:140 Identity:53/140 - (37%)
Similarity:85/140 - (60%) Gaps:9/140 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGVTVSDVCKTTYEEIKKDKKHRYVIFYI-RDEKQIDVETVADRNAEYDQFLEDIQKCGPGECRY 66
            ||:.|:|..|||:.|:::.|.||||:|.| ..:|::.||...:....||.||..:.   ..:|||
plant    13 SGMGVADESKTTFLELQRKKTHRYVVFKIDESKKEVVVEKTGNPTESYDDFLASLP---DNDCRY 74

  Fly    67 GLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLS 131
            .::||:::     |||:.:|.|:|..:|.|.|:.::.|:|||:|.|.|.:.|.|:...|||||.:
plant    75 AVYDFDFV-----TSENCQKSKIFFFAWSPSTSGIRAKVLYSTSKDQLSRELQGIHYEIQATDPT 134

  Fly   132 EASREAVEEK 141
            |...|.:.|:
plant   135 EVDLEVLRER 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 53/140 (38%)
ADF6NP_565719.1 ADF_gelsolin 11..145 CDD:472830 53/140 (38%)

Return to query results.
Submit another query.