DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and ADF5

DIOPT Version :10

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_565390.1 Gene:ADF5 / 816171 AraportID:AT2G16700 Length:143 Species:Arabidopsis thaliana


Alignment Length:143 Identity:42/143 - (29%)
Similarity:89/143 - (62%) Gaps:11/143 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDE-KQIDVETVADRNAEYDQFLEDIQKCGP-GECR 65
            :|:.|:|.|.:::.::|..|.|||::|.|.:: :::.|:.|......|    .|::...| .:||
plant    10 TGMRVTDECTSSFMDMKWKKVHRYIVFKIEEKSRKVTVDKVGGAGESY----HDLEDSLPVDDCR 70

  Fly    66 YGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDL 130
            |.:|||:::     |.::.:|.|:|.::|.|:.:|::.|:||::|.|.|::.|.|:...:||||.
plant    71 YAVFDFDFV-----TVDNCRKSKIFFIAWSPEASKIRAKILYATSKDGLRRVLEGIHYELQATDP 130

  Fly   131 SEASREAVEEKLR 143
            :|...:.::::.:
plant   131 TEMGFDIIQDRAK 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 42/140 (30%)
ADF5NP_565390.1 PLN03216 3..143 CDD:178755 42/141 (30%)

Return to query results.
Submit another query.