DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and Dstn

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001028838.1 Gene:Dstn / 502674 RGDID:1588366 Length:165 Species:Rattus norvegicus


Alignment Length:162 Identity:61/162 - (37%)
Similarity:83/162 - (51%) Gaps:30/162 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSD-VCKTTY----------EEIKKDKKHRYVIFYI-RDEKQIDVE-----TVADRNAE 48
            |||||.|:| ||:..|          |||||.||  .|||.: .|:|.|.||     .|.|....
  Rat     1 MASGVQVADEVCRIFYDMKVRKCSTPEEIKKRKK--AVIFCLSADKKCIVVEEGKEILVGDVGVT 63

  Fly    49 Y-DQFLEDIQKCGPGECRYGLFD--FEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSS 110
            . |.|...:......:|||.|:|  ||       |.||.|::.:|.: |.|:.|.:|.||:|:||
  Rat    64 ITDPFKHFVGMLPEKDCRYALYDASFE-------TKESRKEELMFFL-WAPEQAPLKSKMIYASS 120

  Fly   111 FDALKKSLVGVQKYIQATDLSEASREAVEEKL 142
            .||:||...|::...||....:.:|.::.|||
  Rat   121 KDAIKKKFPGIKHEYQANGPEDLNRTSIAEKL 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 57/158 (36%)
DstnNP_001028838.1 ADF_cofilin_like 3..152 CDD:200442 57/158 (36%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354429
Domainoid 1 1.000 64 1.000 Domainoid score I9863
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5199
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm9096
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.