DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and cfl2

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001011156.1 Gene:cfl2 / 496574 XenbaseID:XB-GENE-1002956 Length:167 Species:Xenopus tropicalis


Alignment Length:172 Identity:60/172 - (34%)
Similarity:85/172 - (49%) Gaps:45/172 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSD-VCK----------TTYEEIKKDKKHRYVIFYIR-DEKQIDVETVADRNAEYDQFL 53
            |||||||:| |.|          :|.|||||.||  .|:|.:. |:|:|.||       |..|.|
 Frog     1 MASGVTVNDEVIKVFNEMKVRKSSTPEEIKKRKK--AVLFCLSPDKKEIIVE-------ETKQIL 56

  Fly    54 -EDIQKCGP------------GECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKM 105
             .||.:..|            .:|||||:|..|      .::.|||:.|..:.|.||.|.:|.||
 Frog    57 VGDIGEAVPDPYRTFVNLLPLDDCRYGLYDATY------ETKESKKEDLVFIFWAPDNAPLKSKM 115

  Fly   106 LYSSSFDALKKSLVGVQKYIQATDLSEASREAVEEKLRATDR 147
            :|:||.||:||...|::...|...|.:     ::::....|:
 Frog   116 IYASSKDAIKKKFTGIKHEWQVNGLDD-----IKDRCTLADK 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 57/163 (35%)
cfl2NP_001011156.1 ADF_cofilin_like 3..153 CDD:200442 58/170 (34%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9942
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5107
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm9514
Panther 1 1.100 - - LDO PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.110

Return to query results.
Submit another query.