DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and cfl1l

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_998804.1 Gene:cfl1l / 406738 ZFINID:ZDB-GENE-040426-2770 Length:163 Species:Danio rerio


Alignment Length:155 Identity:56/155 - (36%)
Similarity:81/155 - (52%) Gaps:19/155 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSDVCKTTYEEIK-----KDKKHRYVIFYIR---DEKQIDVE-----TVADRNAEYDQF 52
            |||||.:||.....||.|:     .|:|.|:.:..:|   |.|.|.|:     .|.|...|.|.|
Zfish     1 MASGVAISDDVIAHYELIRVRLQGTDEKERFKLVVMRLSDDLKNIIVDEKNCLKVKDVENEKDVF 65

  Fly    53 LEDIQKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKS 117
            .:.|....|.||||.|:|.:|.::     ||.|:..:|:.| .||.|.::.||||:||.:|||..
Zfish    66 KKIISMLPPKECRYALYDCKYTNK-----ESVKEDLVFIFS-APDDAPMRSKMLYASSKNALKAK 124

  Fly   118 LVGVQKYIQATDLSEASREAVEEKL 142
            |.|::...|..|.::....::.|||
Zfish   125 LPGMKFEWQINDNADKDASSLVEKL 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 52/151 (34%)
cfl1lNP_998804.1 ADF_cofilin_like 3..149 CDD:200442 52/151 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596734
Domainoid 1 1.000 66 1.000 Domainoid score I9908
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5205
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm6541
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.