DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and cfl2

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_991263.1 Gene:cfl2 / 403001 ZFINID:ZDB-GENE-040426-1815 Length:166 Species:Danio rerio


Alignment Length:161 Identity:59/161 - (36%)
Similarity:82/161 - (50%) Gaps:27/161 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSD-VCK----------TTYEEIKKDKKHRYVIFYIRDE-KQIDVE-----TVADRNAE 48
            ||||||||| |.|          ::.:|:||.||  .|:|.:.|: |:|.||     .|.|....
Zfish     1 MASGVTVSDEVIKVFNDMKVRKSSSSDEVKKRKK--AVLFCLSDDKKKIIVEEGRQILVGDIGDS 63

  Fly    49 YDQFLEDIQKCGP-GECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFD 112
            .|.......|..| .:|||||:|..|      .::.|||:.|..:.|.|:.|.:|.||:|:||.|
Zfish    64 VDDPYACFVKLLPLNDCRYGLYDATY------ETKESKKEDLVFIFWAPEGAPLKSKMIYASSKD 122

  Fly   113 ALKKSLVGVQKYIQATDLSE-ASREAVEEKL 142
            |:||...|::...|...|.: ..|..:.|||
Zfish   123 AIKKKFTGIKHEWQVNGLDDIQDRSTLAEKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 55/157 (35%)
cfl2NP_991263.1 ADF_cofilin_like 3..153 CDD:200442 55/157 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596732
Domainoid 1 1.000 66 1.000 Domainoid score I9908
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5205
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm6541
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - LDO PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1312.840

Return to query results.
Submit another query.