DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and cfl1

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_998806.1 Gene:cfl1 / 321496 ZFINID:ZDB-GENE-030131-215 Length:165 Species:Danio rerio


Alignment Length:156 Identity:50/156 - (32%)
Similarity:85/156 - (54%) Gaps:20/156 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSDVCKTTYEEIK----------KDKKHRYVIFYIRDEKQ-IDVETVAD--RNAEYDQF 52
            |||||||.:...|.:.|:|          |.|:.:.|:|.:.|:|: |.:|...:  :..|.|.:
Zfish     1 MASGVTVEETVLTVFNEMKVRKAHCNEEEKSKRKKAVMFCLSDDKKHIIMEQGQEILQGDEGDPY 65

  Fly    53 LEDIQKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKS 117
            |:.::...|.:|||.|:|..|      .::.:||:.|..:.|.|::|.:|.||:|:||.||:||.
Zfish    66 LKFVKMLPPNDCRYALYDATY------ETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKK 124

  Fly   118 LVGVQKYIQATDLSE-ASREAVEEKL 142
            ..|::...|...:.: ..|:.:.|||
Zfish   125 FTGIKHEWQVNGMDDIKDRKTLAEKL 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 46/152 (30%)
cfl1NP_998806.1 ADF_cofilin_like 3..150 CDD:200442 46/152 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170596733
Domainoid 1 1.000 66 1.000 Domainoid score I9908
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 80 1.000 Inparanoid score I5205
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm6541
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.