DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and Cfl1

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_058843.1 Gene:Cfl1 / 29271 RGDID:69285 Length:166 Species:Rattus norvegicus


Alignment Length:167 Identity:60/167 - (35%)
Similarity:84/167 - (50%) Gaps:39/167 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSD-VCK----------TTYEEIKKDKKHRYVIFYI-RDEKQIDVE------------T 41
            |||||.||| |.|          :|.||:||.||  .|:|.: .|:|.|.:|            |
  Rat     1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKK--AVLFCLSEDKKNIILEEGKEILVGDVGQT 63

  Fly    42 VADRNAEYDQFLEDIQKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKML 106
            |.|....:.:.|.|      .:|||.|:|..|      .::.|||:.|..:.|.|::|.:|.||:
  Rat    64 VDDPYTTFVKMLPD------KDCRYALYDATY------ETKESKKEDLVFIFWAPESAPLKSKMI 116

  Fly   107 YSSSFDALKKSLVGVQKYIQATDLSEA-SREAVEEKL 142
            |:||.||:||.|.|::..:||....|. .|..:.|||
  Rat   117 YASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 56/163 (34%)
Cfl1NP_058843.1 ADF_cofilin_like 3..153 CDD:200442 56/163 (34%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166354431
Domainoid 1 1.000 64 1.000 Domainoid score I9863
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 72 1.000 Inparanoid score I5199
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm9096
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - O PTHR11913
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.