DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and adf1

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_594741.1 Gene:adf1 / 2541738 PomBaseID:SPAC20G4.06c Length:137 Species:Schizosaccharomyces pombe


Alignment Length:143 Identity:55/143 - (38%)
Similarity:84/143 - (58%) Gaps:15/143 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 SGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQIDVETVADRNA---EYDQFLEDIQKCGPGEC 64
            |||.||..|...::|:|..|..|||:|.:.|.|   .|.|.::.:   ::|.||.|:.:   .:|
pombe     4 SGVKVSPECLEAFQELKLGKSLRYVVFKMNDTK---TEIVVEKKSTDKDFDTFLGDLPE---KDC 62

  Fly    65 RYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATD 129
            ||.::|||: :..:|.     :.|:..:||.||.|.:|.||:||||.|.|:::..|:...|||||
pombe    63 RYAIYDFEF-NLGEGV-----RNKIIFISWSPDVAPIKSKMVYSSSKDTLRRAFTGIGTDIQATD 121

  Fly   130 LSEASREAVEEKL 142
            .||.:.|.|.||:
pombe   122 FSEVAYETVLEKV 134

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 54/141 (38%)
adf1NP_594741.1 ADF_cofilin_like 4..134 CDD:200442 54/141 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 90 1.000 Domainoid score I2064
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1686
OMA 1 1.010 - - QHG53544
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - otm47257
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - LDO PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.