DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tsr and Cfl2

DIOPT Version :9

Sequence 1:NP_477034.1 Gene:tsr / 37841 FlyBaseID:FBgn0011726 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_031714.1 Gene:Cfl2 / 12632 MGIID:101763 Length:166 Species:Mus musculus


Alignment Length:168 Identity:63/168 - (37%)
Similarity:85/168 - (50%) Gaps:41/168 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGVTVSD-VCK----------TTYEEIKKDKKHRYVIFYIRDEK-QIDVE------------T 41
            |||||||:| |.|          :|.|||||.||  .|:|.:.|:| ||.||            |
Mouse     1 MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKK--AVLFCLSDDKRQIIVEEAKQILVGDIGDT 63

  Fly    42 VADRNAEYDQFLEDIQKCGP-GECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKM 105
            |.|   .|..|:    |..| .:|||.|:|..|      .::.|||:.|..:.|.|::|.:|.||
Mouse    64 VED---PYTSFV----KLLPLNDCRYALYDATY------ETKESKKEDLVFIFWAPESAPLKSKM 115

  Fly   106 LYSSSFDALKKSLVGVQKYIQATDLSE-ASREAVEEKL 142
            :|:||.||:||...|::...|...|.: ..|..:.|||
Mouse   116 IYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKL 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tsrNP_477034.1 ADF_cofilin_like 3..142 CDD:200442 59/164 (36%)
Cfl2NP_031714.1 ADF_cofilin_like 3..153 CDD:200442 59/164 (36%)
Nuclear localization signal. /evidence=ECO:0000255 30..34 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167850724
Domainoid 1 1.000 65 1.000 Domainoid score I9989
eggNOG 1 0.900 - - E1_KOG1735
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 74 1.000 Inparanoid score I5265
Isobase 1 0.950 - 0 Normalized mean entropy S1466
OMA 1 1.010 - - QHG53544
OrthoDB 1 1.010 - - D1370477at2759
OrthoFinder 1 1.000 - - FOG0000392
OrthoInspector 1 1.000 - - mtm8850
orthoMCL 1 0.900 - - OOG6_100500
Panther 1 1.100 - - LDO PTHR11913
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2387
SonicParanoid 1 1.000 - - X134
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.