DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment KCNQ1 and rpl3703

DIOPT Version :9

Sequence 1:	NP_000209.2	Gene:	KCNQ1 / 3784	HGNCID:	6294	Length:	676	Species:	Homo sapiens
Sequence 2:	NP_001018221.1	Gene:	rpl3703 / 3361407	PomBaseID:	SPAPB17E12.05	Length:	89	Species:	Schizosaccharomyces pombe

Alignment Length:	48	Identity:	13/48 - (27%)
Similarity:	16/48 - (33%)	Gaps:	6/48 - (12%)

- Green bases have known domain annotations that are detailed below.

Human     8 PRAERKRWGWGRLPGARR----GSAGLAKKC--PFSLELAEGGPAGGA 49
            |.|:.:.:.||.....||    |.....||.  .|......|.|...|
pombe    40 PAAKTRSYNWGAKAKRRRTTGTGRMSYLKKVHRSFKNGFRAGKPTSAA 87

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
KCNQ1	NP_000209.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	1..28		7/23 (30%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	62..84
		Ion_trans	153..359	CDD:278921
		Ion_trans_2	270..349	CDD:285168
		Selectivity filter. /evidence=ECO:0000250	312..317
		Interaction with CALM. /evidence=ECO:0000269\|PubMed:25441029	370..382
		KCNQ_channel	<511..617	CDD:281513
		Interaction with CALM, calcium-dependent. /evidence=ECO:0000269\|PubMed:25441029	515..529
		Interaction with KCNE1 C-terminus. /evidence=ECO:0000269\|PubMed:25037568	535..572
		Interaction with AKAP9. /evidence=ECO:0000269\|PubMed:11799244	588..616
		C-terminal assembly domain. /evidence=ECO:0000269\|PubMed:10654932	589..620
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	620..676
rpl3703	NP_001018221.1	PTZ00073	1..81	CDD:240257	10/40 (25%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2126
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900