DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAN1 and RBM39

DIOPT Version :9

Sequence 1:NP_001286812.1 Gene:MAN1 / 37838 FlyBaseID:FBgn0034962 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_909122.1 Gene:RBM39 / 9584 HGNCID:15923 Length:530 Species:Homo sapiens


Alignment Length:94 Identity:22/94 - (23%)
Similarity:44/94 - (46%) Gaps:2/94 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   540 TPCLKIRHMFDSSEVDQANLKQSIVESIIEKVGTRCKICDVQLDVQSC--CVYIRCASEEDAGTI 602
            |.|.::.:||:....::......|.:.:||:......:..:.:|..|.  .||::|.|...|...
Human   423 TQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAA 487

  Fly   603 HKEINGWWFDKRLISIKFLRLERYLSRFP 631
            ...::|.||..::|:..::.|..|.:.||
Human   488 VNALHGRWFAGKMITAAYVPLPTYHNLFP 516

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAN1NP_001286812.1 LEM 4..47 CDD:128813
MSC <381..509 CDD:286487
RRM_Man1 542..631 CDD:240732 19/90 (21%)
RBM39NP_909122.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..146
SF-CC1 46..518 CDD:273721 22/94 (23%)
Interaction with JUN. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..406
Activating domain. /evidence=ECO:0000250|UniProtKB:Q8VH51 291..355
Interaction with ESR1 and ESR2. /evidence=ECO:0000250|UniProtKB:Q8VH51 355..406
Interaction with NCOA6. /evidence=ECO:0000250|UniProtKB:Q8VH51 406..530 22/94 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D873705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.