DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAN1 and rbm39b

DIOPT Version :9

Sequence 1:NP_001286812.1 Gene:MAN1 / 37838 FlyBaseID:FBgn0034962 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001014392.1 Gene:rbm39b / 541556 ZFINID:ZDB-GENE-050327-97 Length:539 Species:Danio rerio


Alignment Length:128 Identity:29/128 - (22%)
Similarity:54/128 - (42%) Gaps:22/128 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   526 SPAFDN-SNKIANPP-------------------TPCLKIRHMFDSSEVDQANLKQSIVESIIEK 570
            |.:|.| .|..|.||                   |.||::.:||:....::......|.:.:||:
Zfish   398 SVSFGNMPNASATPPLIPNPGMNQAMNLPTQPLATHCLQLSNMFNPQMENEPGWDIEIRDDVIEE 462

  Fly   571 VGTRCKICDVQLDVQSC--CVYIRCASEEDAGTIHKEINGWWFDKRLISIKFLRLERYLSRFP 631
            ......:..:.:|..|.  .||::|.:...|..:...::|.||..::|:..::.|..|.:.||
Zfish   463 CRKHGGVIHIYVDKNSAQGNVYVKCPTIPVAMAVVSSLHGRWFAGKMITAAYVPLPTYHNLFP 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAN1NP_001286812.1 LEM 4..47 CDD:128813
MSC <381..509 CDD:286487
RRM_Man1 542..631 CDD:240732 19/90 (21%)
rbm39bNP_001014392.1 SF-CC1 76..526 CDD:273721 29/128 (23%)
RRM1_RBM39 166..250 CDD:240980
RRM2_RBM23_RBM39 266..338 CDD:240730
RBM39linker 355..450 CDD:292157 12/51 (24%)
RRM3_RBM39_like 432..516 CDD:240731 18/83 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D873705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.