DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAN1 and rbm39a

DIOPT Version :9

Sequence 1:NP_001286812.1 Gene:MAN1 / 37838 FlyBaseID:FBgn0034962 Length:650 Species:Drosophila melanogaster
Sequence 2:NP_001012304.1 Gene:rbm39a / 406251 ZFINID:ZDB-GENE-040426-2852 Length:523 Species:Danio rerio


Alignment Length:108 Identity:24/108 - (22%)
Similarity:52/108 - (48%) Gaps:7/108 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   532 SNKIANPP-----TPCLKIRHMFDSSEVDQANLKQSIVESIIEKVGTRCKICDVQLDVQSC--CV 589
            :|:..|.|     |.|.::.:||:.:..:....:..|.:.:||:......:..:.:|.:|.  .|
Zfish   403 TNQALNLPSQPIATHCFQLSNMFNPNSENDHGWEIEIQDDVIEECNKHGGVIHIYVDKKSAEGNV 467

  Fly   590 YIRCASEEDAGTIHKEINGWWFDKRLISIKFLRLERYLSRFPK 632
            |::|.:...|......::|.||..::|:..::.|..|.:.||:
Zfish   468 YVKCPTIPAAMAAVSALHGRWFGGKMITAAYVPLPTYHNLFPE 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAN1NP_001286812.1 LEM 4..47 CDD:128813
MSC <381..509 CDD:286487
RRM_Man1 542..631 CDD:240732 18/90 (20%)
rbm39aNP_001012304.1 SF-CC1 91..511 CDD:273721 24/108 (22%)
RRM1_RBM39 148..232 CDD:240980
RRM2_RBM23_RBM39 248..320 CDD:240730
RBM39linker 337..432 CDD:292157 7/28 (25%)
RRM3_RBM39_like 416..500 CDD:240731 17/83 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0147
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D873705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.