DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAN1 and rbm23

DIOPT Version :9

Sequence 1:NP_001286812.1 Gene:MAN1 / 37838 FlyBaseID:FBgn0034962 Length:650 Species:Drosophila melanogaster
Sequence 2:XP_004910812.2 Gene:rbm23 / 100144745 XenbaseID:XB-GENE-494491 Length:421 Species:Xenopus tropicalis


Alignment Length:233 Identity:52/233 - (22%)
Similarity:73/233 - (31%) Gaps:72/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 RKH-TRADKLKKRSNKYVLYSKEQQESPPFPQYHQYHAPQPPQNYANGLD--------------- 89
            |.| .|.|:..:..|....|::.:..|   ||:.|...|:.|:...:..:               
 Frog   101 RSHDRRRDEHSRHHNSGRRYTRSRSRS---PQHKQKTPPREPETILSPEERDARTVFCMQLAARI 162

  Fly    90 NNNDLDQTGGSSAYNRSLDESDSSPLQLSASKMYAPPPVVASNYDGDCS----PHSLGLNGKYLQ 150
            .:.||:..  .||..:..|....|......||..|        |...|.    |.::||.|:.| 
 Frog   163 RSRDLEDF--FSAVGKVRDVRIISDRNSRRSKGIA--------YVEFCDIQSVPLAIGLTGQRL- 216

  Fly   151 PCSMPYAIDT-----------SNNY--GKPSGKAKLSDGGVVNRLLSFRDT-TIQRKFNYPTGQA 201
             ..:|..:..           |||.  |.| |..:|..|.     |.|..| .:.|....|.|:.
 Frog   217 -LGVPIIVQVSQAEKNRLAAMSNNLQRGNP-GPMRLYVGS-----LHFNITEDMLRGIFEPFGKI 274

  Fly   202 SRIPLRKE-----------------RLTRFALSDLKSF 222
            ..|.|.||                 ...|.||..|..|
 Frog   275 ENIQLLKEPDTGRSKGFGFITFTDAECARRALEQLNGF 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAN1NP_001286812.1 LEM 4..47 CDD:128813 3/6 (50%)
MSC <381..509 CDD:286487
RRM_Man1 542..631 CDD:240732
rbm23XP_004910812.2 SF-CC1 129..419 CDD:273721 44/202 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D873705at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.