DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3163 and CG3386

DIOPT Version :9

Sequence 1:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster


Alignment Length:380 Identity:75/380 - (19%)
Similarity:128/380 - (33%) Gaps:132/380 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FIDDFIEEYKSNPCLWKADSADFRNRSRRQEAY----AKLIEV-----ATKHGEMYNVERTKQKI 58
            |..:|:..|:..|.||.....::||:..|..||    .||.|:     .|:.|...|:.||..:.
  Fly    16 FWREFLALYQGMPELWDVHHLNYRNKELRNRAYELLERKLREIQPNATRTEVGRRINIFRTNYRR 80

  Fly    59 NNLRCAFRHQLRKYNEVKKKGEKYEPYCPKRRYFESLMFLKDEEI-----------PADKKFKRE 112
            ..:|...:.:|..::::.|         |...:::.:.||..:|.           ...:.|:||
  Fly    81 EQMRILKQKELGLHSDLCK---------PTLWFYDYMGFLLTQETFQHRTRKGRGGRQKQDFRRE 136

  Fly   113 QSVCLDNSMQLGAPENGDEYSDAESLHKPPKPTADSIKMSPNNSANEFCANIFEEAAAAAAADPV 177
            :.               |:|.     .|.|....:|:...|....|.|  |...|..|..:.:  
  Fly   137 KD---------------DKYP-----LKNPDLNTESVCDWPIKDDNAF--NYQSEPTAPQSEE-- 177

  Fly   178 ISIKTVNNANSHASGATIK-EVEIVVPANNRLLSARRKSVPDSIKSPPGDSESPQCKRIVTQNQT 241
                          |:.:. ::||:.|                        |..||:   .:.:.
  Fly   178 --------------GSLLSPKLEIIEP------------------------EEGQCE---VKEEN 201

  Fly   242 KLISNQSPSQKANHITRKRSSSVSSQISEDNEPPPGKFRADISTIDFERLFSLALKSADSQLDDH 306
            .|         .|.:..|..:| |.|...:||                      ..:|..||.:.
  Fly   202 SL---------GNSLETKEPTS-SIQTDPENE----------------------RGTAPMQLSES 234

  Fly   307 FSNFGKIIAHKLRSMDGTQAIYAEKIIADVLYQGQMKMLSSLSIHQFMGVDNATV 361
            .....:..|.:...|..||.|.|.|.|||:|::|.|   .:|.:::  |...:||
  Fly   235 SEVLARSWAIQYEEMSPTQRILARKAIADILFEGCM---GNLRVNR--GEQQSTV 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510 22/99 (22%)
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 22/99 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468899
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CAYR
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.