DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3163 and CG5953

DIOPT Version :9

Sequence 1:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_001260503.1 Gene:CG5953 / 34985 FlyBaseID:FBgn0032587 Length:701 Species:Drosophila melanogaster


Alignment Length:171 Identity:43/171 - (25%)
Similarity:72/171 - (42%) Gaps:24/171 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 SHASGATIKEVEIVVPANNRLLSARRKSVPDSIKSPPG-DSESPQCKRIVTQNQTKLISNQSPSQ 251
            |::|......:::|..|.:..::..:.:....|..|.| |:.:|    .:..|..||....|   
  Fly   533 SYSSAGEESRLQLVDMAQDLRVAQAKANFGAFILPPRGSDASTP----AMPLNMRKLTGAGS--- 590

  Fly   252 KANHITRKRSSSVSSQISEDNEP------------PPGKFRADISTIDFERLFSLALKSADSQLD 304
             |.|:...........:|:..||            .||..::.:|.   :...:.:...|:|...
  Fly   591 -AGHMLMNSLLGSRESMSDGEEPDPDNDEATESAASPGHIKSSVSA---QAAVAASAFYAESLNR 651

  Fly   305 DHFSNFGKIIAHKLRSMDGTQAIYAEKIIADVLYQGQMKML 345
            |.....|..::.|||:||.||.|.|||:|::|||.||...|
  Fly   652 DDCDFIGSNVSLKLRTMDRTQRIIAEKLISEVLYYGQFNEL 692

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510
CG5953NP_001260503.1 MADF_DNA_bdg 86..170 CDD:287510
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.