DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3163 and CG15601

DIOPT Version :9

Sequence 1:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster


Alignment Length:353 Identity:75/353 - (21%)
Similarity:129/353 - (36%) Gaps:99/353 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 IDDFIEEYKSNPCLWKADSADFRNRSRRQEAYAKLIEVATKHGEMYNVERTKQKINNLRCAFRHQ 68
            |.:|:|.|:..|||:......::||..|:|||..:|. :.|..:: .|...|.||.::|..:..:
  Fly    11 ITEFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIR-SLKIPQL-TVSDIKLKIKSVRTVYSKE 73

  Fly    69 LRKYNEVKKKGEKYEPYCPKRRYFESLMFLKDEEIPADKKFKREQSVCLDNSMQLGAPENGDEYS 133
            ||.:...|:.|..||   ||..:|.    |.|..:         :||.|.:..:.|         
  Fly    74 LRIWMREKELGRTYE---PKLFWFR----LADSFL---------RSVSLSHCKRQG--------- 113

  Fly   134 DAESLHKPPKPTADSIKMSPNNSANEFCANIFEEAAA----AAAADPVISIKTVNNANSHASGAT 194
                               .|||::.....|..:..:    .||||..:|...:...::..:|. 
  Fly   114 -------------------KNNSSSAQLTTIKSDETSKLLCTAAADITMSEDALEEEDAEVNGE- 158

  Fly   195 IKEVEIVVPANNRLLSARRKSVPDSIKSPPGDSESPQCKRIVTQNQTKLISNQSPSQKANHITRK 259
                                  |:..   |.:...|... |...:.|..:::| |.|:  |.::.
  Fly   159 ----------------------PEEC---PLEESRPTAS-ICKDDSTLCLADQ-PQQE--HYSQG 194

  Fly   260 RSSSVSSQISEDNEPPPGKFRADISTIDFERLFSLALKSADSQLDDHFSNFGKIIAHKLRSM-DG 323
            .||  |.|:.........|:                :.|.||..:|....||:.||.:||:: |.
  Fly   195 CSS--SQQLPHTMAQRKSKY----------------ITSLDSAGEDDLIIFGQSIASQLRTIPDS 241

  Fly   324 TQAIYAEKIIADVLYQGQMKMLSSLSIH 351
            .....|:..|..||::.:.....|..::
  Fly   242 YSRSVAKLRIQQVLFEAETGQFQSTEVN 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510 28/90 (31%)
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 30/95 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468887
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.