DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3163 and CG4004

DIOPT Version :9

Sequence 1:NP_611872.1 Gene:CG3163 / 37836 FlyBaseID:FBgn0034961 Length:368 Species:Drosophila melanogaster
Sequence 2:NP_727638.2 Gene:CG4004 / 32226 FlyBaseID:FBgn0030418 Length:359 Species:Drosophila melanogaster


Alignment Length:405 Identity:93/405 - (22%)
Similarity:150/405 - (37%) Gaps:122/405 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MDFIDDFIEEYKSNPCLWKADSADFRNRSRRQEAYAKLIEVATKHGEMYNVERTKQKINNLRCAF 65
            :||...|:..|:|.|.||...|..:|:|..:.|:|::|:|:........|:...|:||||.|.::
  Fly     8 IDFWKKFLGLYRSMPELWLVRSKLYRDRQLKLESYSRLLELLRTTDSYANIHTLKRKINNFRTSY 72

  Fly    66 RHQLRKYNEVKKKGEKYEPYCPKRRYFESLMFLKDEE---------IPADKKFKREQSVCLDNS- 120
            |.:|||   |...|..|:   |...||:.|.||.:.|         :.||:...|...|..:.| 
  Fly    73 RRELRK---VLDSGNTYK---PTLWYFKELDFLYELETGELQLEGIVAADRDLVRNSKVLQNESN 131

  Fly   121 ---------------------------------MQLGAPENGDEYSDAESLHKPPKPTADSI--- 149
                                             ||....|:.|..|||.. |:......|::   
  Fly   132 KTITFGAQLAEQEVSMSFIVKREIEVDENITEDMQQLETEDVDIMSDAFP-HEEDMLRLDAVGDG 195

  Fly   150 ----KMSPNNSANEFCANIFEEAAAAAAADPVISIKTVNNANSHASGATIKEVEIVVPANNRLLS 210
                :..|:|                   ||     .::|.:.|..                  .
  Fly   196 DVEPEPEPDN-------------------DP-----ELDNMDDHVD------------------D 218

  Fly   211 ARRKSVPDSIKSPPGDSESPQCKRIVTQNQTKLISNQSPSQKANHI-TRKRSSSVSSQISEDNEP 274
            .|..|...|||:      :...:..|:.:|.....:|:..:....| .|:|.||..:...|    
  Fly   219 YRNNSSAGSIKN------NGYQQHTVSSHQQHNGESQTSDKSGRRIRNRRRRSSNDTDYVE---- 273

  Fly   275 PPGKFRADISTIDFERLFSLALKSADSQLD-DHFSN-------FGKIIAHKLRSMDGTQAIYAEK 331
             ..:.|.::.|.:.:|.:.   :..|.:.| .|.|:       .||.:|...|.|...|.::||:
  Fly   274 -AARKRRNVETSNRDRDWH---RERDRERDRKHESDSEYECELIGKRMASHFRRMRPDQRLFAER 334

  Fly   332 IIADVLYQGQMKMLS 346
            ||::||..|:|..||
  Fly   335 IISEVLVYGRMNRLS 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3163NP_611872.1 MADF_DNA_bdg 7..98 CDD:287510 31/90 (34%)
CG4004NP_727638.2 MADF_DNA_bdg 14..99 CDD:402258 31/90 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468898
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0009991
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.030

Return to query results.
Submit another query.