DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ADK1

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_201145.1 Gene:ADK1 / 836459 AraportID:AT5G63400 Length:246 Species:Arabidopsis thaliana


Alignment Length:205 Identity:119/205 - (58%)
Similarity:160/205 - (78%) Gaps:0/205 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI 86
            |.:||||||||||:|::|:::|:|||||||||||.::|.:.||.:.|:.|:.|:||||||||.:|
plant    37 IFIGPPGSGKGTQSPVVKDEYCLCHLSTGDMLRAAVASKTPLGVKAKEAMEKGELVSDDLVVGII 101

  Fly    87 DSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQAS 151
            |..::||:|:.||:||||||||.||||||.:|.:|.|.:|.|:.|||||::|..|||||.||.:|
plant   102 DEAMNKPKCQKGFILDGFPRTVTQAEKLDEMLKRRGTEIDKVLNFAIDDAILEERITGRWIHPSS 166

  Fly   152 GRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVDAA 216
            |||||.:|||||.|..||:||||||:|.||||:.||.||.|:|.||:|::|||..:.:...:.|.
plant   167 GRSYHTKFAPPKTPGVDDITGEPLIQRKDDNADVLKSRLAAFHSQTQPVIDYYAKKAVLTNIQAE 231

  Fly   217 KKSSDVFSTI 226
            |...:|.|.:
plant   232 KAPQEVTSEV 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 119/205 (58%)
ADK 20..222 CDD:238713 117/199 (59%)
ADK1NP_201145.1 PLN02674 3..246 CDD:178279 119/205 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 255 1.000 Domainoid score I496
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1227
Inparanoid 1 1.050 262 1.000 Inparanoid score I965
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 1 1.000 - - FOG0003181
OrthoInspector 1 1.000 - - otm3419
orthoMCL 1 0.900 - - OOG6_100712
Panther 1 1.100 - - O PTHR23359
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2141
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.930

Return to query results.
Submit another query.