DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and PYR6

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_850867.1 Gene:PYR6 / 832710 AraportID:AT5G26667 Length:208 Species:Arabidopsis thaliana


Alignment Length:214 Identity:67/214 - (31%)
Similarity:104/214 - (48%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMID 87
            :||.||||||||...:.|.:...|||.||:|||||.|||:.|..::.::..||:|..::.:.:  
plant    19 VLGGPGSGKGTQCAYIVEHYGYTHLSAGDLLRAEIKSGSENGTMIQNMIKEGKIVPSEVTIKL-- 81

  Fly    88 SNLDKPECKNG---FLLDGFPRTV---VQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRL 146
              |.|...:||   ||:|||||..   ...||:..:..|      .|:.|...:..:.:|:.|| 
plant    82 --LQKAIQENGNDKFLIDGFPRNEENRAAFEKVTEIEPK------FVLFFDCPEEEMEKRLLGR- 137

  Fly   147 IHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHF 211
             :|.                           |.|||.|.::||.:.:.:.:.|::.||..:|...
plant   138 -NQG---------------------------REDDNIETIRKRFKVFLESSLPVIHYYEAKGKVR 174

  Fly   212 KVDAAKKSSDVFSTIDSIF 230
            |::|||....||..:.:||
plant   175 KINAAKPIEAVFEEVKAIF 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 67/214 (31%)
ADK 20..222 CDD:238713 63/204 (31%)
PYR6NP_850867.1 UMP_CMP_kin_fam 16..194 CDD:273576 67/214 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.