DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AT4G25280

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001320061.1 Gene:AT4G25280 / 828631 AraportID:AT4G25280 Length:259 Species:Arabidopsis thaliana


Alignment Length:228 Identity:68/228 - (29%)
Similarity:109/228 - (47%) Gaps:42/228 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ERYEP--ENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMD 72
            ||..|  |.......:||.||||||||...:.|.|.:.|||.||:||.||:..::.||.:..::.
plant    43 ERVSPPKEKAPFITFVLGGPGSGKGTQCEKIVETFGLQHLSAGDLLRREIAMHTENGAMILNLIK 107

  Fly    73 AGKLVSDDLVVDMIDSNLDKPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSL 137
            .||:|..::.|.:|...|:..:.:. ||:||||||.......:.::   :.:.|.|:.|...:..
plant   108 DGKIVPSEVTVKLIQKELESSDNRK-FLIDGFPRTEENRVAFERII---RADPDVVLFFDCPEEE 168

  Fly   138 LVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVD 202
            :|:|:..|  :|.                           |.|||...:||||:.::...:|::|
plant   169 MVKRVLNR--NQG---------------------------RIDDNITTMKKRLKIFNALNRPVID 204

  Fly   203 YYGLRGLHFKVDAAKKSSDVFSTIDSIFQRKRP 235
            ||..:|..:.::|.       .|:|.|||...|
plant   205 YYKNKGKLYTINAV-------GTVDDIFQHVLP 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 63/212 (30%)
ADK 20..222 CDD:238713 58/201 (29%)
AT4G25280NP_001320061.1 PLN02200 11..244 CDD:215125 68/228 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100712
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.800

Return to query results.
Submit another query.