DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AT3G01820

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_186831.2 Gene:AT3G01820 / 821071 AraportID:AT3G01820 Length:263 Species:Arabidopsis thaliana


Alignment Length:210 Identity:51/210 - (24%)
Similarity:91/210 - (43%) Gaps:35/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 GINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLV 82
            |:..:|:|.||:.:...|..|.:...|.|:|.|.::|.|::..|.|..|:...::..|||...:|
plant    62 GVQWVLMGAPGAWRHVFAERLSKLLEVPHISMGSLVRQELNPRSSLYKEIASAVNERKLVPKSVV 126

  Fly    83 VDMIDSNLDKPECK--NGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGR 145
            ..::...|::...:  .||:|.|.|||..|||.||.:     ..:|.|:.....:..||.|    
plant   127 FALLSKRLEEGYARGETGFILHGIPRTRFQAETLDQI-----AQIDLVVNLKCSEDHLVNR---- 182

  Fly   146 LIHQASGRSYHEEFAPPKKPMTDDVTGEPL-IRRSDDNAEALKKRLEAYHKQTKPLVDYYG---- 205
                       .|.|.|::.....:...|: |....::.....:.:|.|:::.:.|:|::.    
plant   183 -----------NETALPQQEFLGSMLHSPVAINARRESVGVYAQEVEEYYRKQRKLLDFHVGGAT 236

  Fly   206 --------LRGLHFK 212
                    |..||.|
plant   237 SADTWQGLLAALHLK 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 50/208 (24%)
ADK 20..222 CDD:238713 50/208 (24%)
AT3G01820NP_186831.2 PLN02459 60..250 CDD:215253 49/207 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.970

Return to query results.
Submit another query.