DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AT2G39270

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_850314.1 Gene:AT2G39270 / 818512 AraportID:AT2G39270 Length:295 Species:Arabidopsis thaliana


Alignment Length:230 Identity:76/230 - (33%)
Similarity:125/230 - (54%) Gaps:26/230 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPNAAVPVERYEPENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGA 65
            :..:::.....|:..|  .:.:.||.||.||||.|..|.....|.|::|||::|.|:||...|.:
plant    49 LGKSSSTSTSPYKGRN--FHWVFLGCPGVGKGTYASRLSSLLGVPHIATGDLVREELSSSGLLSS 111

  Fly    66 ELKKVMDAGKLVSDDLVVDMIDSNLD--KPECKNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAV 128
            :||::::.||||.|:.::.::...|.  |.:.::|::||||||||.|||.|:.:     ||:|.|
plant   112 QLKELVNHGKLVPDEFIISLLSKRLQAGKDKGESGYILDGFPRTVTQAEILEGV-----TNIDLV 171

  Fly   129 IEFAIDDSLLVRRITGRLIHQASGRSYH-------------EEFAPPKKPMTDDVTGEPLIRRSD 180
            |...:.:..|:.:..||.|....|.:|:             ..:.||..|..:  ....||.|:|
plant   172 INLKLREEALLAKCLGRRICSECGGNYNVACIDIKGDDDTPRMYMPPLLPPPN--CESKLISRAD 234

  Fly   181 DNAEALKKRLEAYHKQTKPLVDYYGLRG--LHFKV 213
            |..|.:|:||..|:|.|:|:.::|..||  |.|::
plant   235 DTEEVVKERLRIYNKMTQPVEEFYKKRGKLLEFEL 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 74/211 (35%)
ADK 20..222 CDD:238713 74/211 (35%)
AT2G39270NP_850314.1 PLN02459 37..295 CDD:215253 76/230 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.