DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ADK

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_181262.1 Gene:ADK / 818302 AraportID:AT2G37250 Length:284 Species:Arabidopsis thaliana


Alignment Length:240 Identity:74/240 - (30%)
Similarity:125/240 - (52%) Gaps:38/240 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 APNAAVP--------VERYEPENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIS 58
            |.:|:.|        ..|..|::..:..:.||.||.||||.|..|.....|.|::|||::|.|::
plant    27 ASHASSPSPFLHGGGASRVAPKDRNVQWVFLGCPGVGKGTYASRLSTLLGVPHIATGDLVREELA 91

  Fly    59 SGSKLGAELKKVMDAGKLVSDDLVVDMIDSNLDKPECK--NGFLLDGFPRTVVQAEKLDTLLDKR 121
            |...|..:|.::::.||||||:::||::...|:..|.:  :||:|||||||:.|||.|..:    
plant    92 SSGPLSQKLSEIVNQGKLVSDEIIVDLLSKRLEAGEARGESGFILDGFPRTMRQAEILGDV---- 152

  Fly   122 KTNLDAVIEFAIDDSLLVRRITGRLIHQASGRSYH-----------------EEFAPPKKPMTDD 169
             |::|.|:...:.:.:||.:..||......|:.::                 :...||.:.|:  
plant   153 -TDIDLVVNLKLPEEVLVDKCLGRRTCSQCGKGFNVAHINLKGENGRPGISMDPLLPPHQCMS-- 214

  Fly   170 VTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFKVD 214
                .|:.|:||..|.:|.||..|::.::||.:||..:|...:.|
plant   215 ----KLVTRADDTEEVVKARLRIYNETSQPLEEYYRTKGKLMEFD 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 69/214 (32%)
ADK 20..222 CDD:238713 69/214 (32%)
ADKNP_181262.1 PLN02459 25..284 CDD:215253 74/240 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23359
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.980

Return to query results.
Submit another query.