DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ak2 and Ak7

DIOPT Version :10

Sequence 1:NP_523836.2 Gene:Ak2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_084463.1 Gene:Ak7 / 78801 MGIID:1926051 Length:723 Species:Mus musculus


Alignment Length:127 Identity:34/127 - (26%)
Similarity:56/127 - (44%) Gaps:32/127 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEIS------------SGSKLGAE----- 66
            |...:||||..||.:.:..|.:.:.:.|:...|::...|:            .|.:.|.|     
Mouse   368 IKICILGPPAVGKSSISEELAKYYKLHHIKMKDVIAEAIAKLEAIVAPKDSVEGEEEGEEEEEEE 432

  Fly    67 -----------LKKVMD--AGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVVQAEKL 114
                       :|:.|:  ||:| .|..::..:...|....|:| ||:|||||:|..||:.|
Mouse   433 NVDDAQELLDGIKESMEQNAGRL-EDQYIIRFVKEKLKSMPCRNQGFILDGFPKTYDQAKDL 493

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ak2NP_523836.2 Adk 20..229 CDD:440329 33/126 (26%)
Ak7NP_084463.1 WcaG 84..297 CDD:440220
ADK 369..>548 CDD:238713 33/126 (26%)
DD_AK7 679..719 CDD:438536
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.