DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and Ak8

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_006498350.1 Gene:Ak8 / 68870 MGIID:1916120 Length:508 Species:Mus musculus


Alignment Length:184 Identity:47/184 - (25%)
Similarity:96/184 - (52%) Gaps:9/184 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI 86
            :|.||.||||..||.||.:|:.:.::|.|.:|:..:::.|..|..::...:....|.|.::..::
Mouse   301 LLCGPLGSGKRLQATLLAQKYGLVNISCGQLLKEAVAAKSSFGELIQPFFEKRMTVPDSIITKVL 365

  Fly    87 DSNLDKPEC-KNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLIHQA 150
            ...:::.:| :.|::|.||||.:.||..|:::    ..|.:.|...::....::.|:|.|.....
Mouse   366 ADRMEQQDCIQKGWVLHGFPRDLDQARMLNSM----GYNPNRVFFLSVPLDSILERLTLRRTDPV 426

  Fly   151 SGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYY 204
            :|..:|..:.||.   |.:|... |::...|:.|.:|.:.:.:::.:..|..||
Mouse   427 TGERFHLMYKPPP---TIEVQVR-LLQNPKDSEEYIKLQTDLFYRNSGDLEQYY 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 47/184 (26%)
ADK 20..222 CDD:238713 47/184 (26%)
Ak8XP_006498350.1 ADK 88..278 CDD:238713
ADK 299..491 CDD:238713 47/184 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.