Sequence 1: | NP_523836.2 | Gene: | Adk2 / 37834 | FlyBaseID: | FBgn0283494 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001357742.1 | Gene: | Ak9 / 633979 | MGIID: | 2685080 | Length: | 1879 | Species: | Mus musculus |
Alignment Length: | 221 | Identity: | 54/221 - (24%) |
---|---|---|---|
Similarity: | 91/221 - (41%) | Gaps: | 48/221 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 PNAAVPVERYEPENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISS--GSKLGA 65
Fly 66 ELKKVMDAGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVI 129
Fly 130 EFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYH 194
Fly 195 KQTKPLVDYYG--------LRGLHFK 212 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk2 | NP_523836.2 | adk | 20..233 | CDD:234711 | 50/204 (25%) |
ADK | 20..222 | CDD:238713 | 50/204 (25%) | ||
Ak9 | NP_001357742.1 | adk | 34..286 | CDD:273569 | |
Ribosomal_L24e_L24 | <926..956 | CDD:382277 | |||
ADK | 962..1177 | CDD:238713 | |||
ADK | 1381..1553 | CDD:238713 | 47/198 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |