DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and Ak9

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001357742.1 Gene:Ak9 / 633979 MGIID:2685080 Length:1879 Species:Mus musculus


Alignment Length:221 Identity:54/221 - (24%)
Similarity:91/221 - (41%) Gaps:48/221 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 PNAAVPVERYEPENIGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISS--GSKLGA 65
            |.|.:||          ..:::|||.|||.|.|..|...:.:..||.||.||..:::  .|:|..
Mouse  1374 PKATMPV----------RIMIVGPPKSGKTTVAKKLASDYGLRCLSVGDALRGMLNNHPDSELSL 1428

  Fly    66 ELKKVMDAGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVI 129
            .|...:..||.|.|:|.:..:|.:|.:..|.. |.::||:|.|..|.:    ||:.|......:.
Mouse  1429 MLNWHLHKGKTVPDELAIQALDISLMESVCNTIGVVIDGYPVTPHQMD----LLEARSIIPMVIF 1489

  Fly   130 EFAIDDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYH 194
            |..:....:.:|:   |:.              ||  |:.....||    .::::.:..:...||
Mouse  1490 ELHVPSKEIFKRL---LLE--------------KK--TEQSMSYPL----HNSSQIIAYKNAKYH 1531

  Fly   195 KQTKPLVDYYG--------LRGLHFK 212
            |....:..:|.        :.|.|.|
Mouse  1532 KNINEIRQFYQKQHQNWHVIDGFHSK 1557

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 50/204 (25%)
ADK 20..222 CDD:238713 50/204 (25%)
Ak9NP_001357742.1 adk 34..286 CDD:273569
Ribosomal_L24e_L24 <926..956 CDD:382277
ADK 962..1177 CDD:238713
ADK 1381..1553 CDD:238713 47/198 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.