DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AT3G60961

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001118870.1 Gene:AT3G60961 / 6241017 AraportID:AT3G60961 Length:136 Species:Arabidopsis thaliana


Alignment Length:162 Identity:40/162 - (24%)
Similarity:73/162 - (45%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 GKLVSDDLVVDMIDSNLDKPECKNG---FLLDGFPRTVVQAEKLDTLLDKRKTNLDA--VIEFAI 133
            |::|..::.|.::...:::....:|   ||:|||||     .:.:.::.:....::.  |:.|..
plant     5 GRIVPSEITVKLLCKAMEESFQVSGNDKFLIDGFPR-----NEENRIVFENVARIEPAFVLFFDC 64

  Fly   134 DDSLLVRRITGRLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTK 198
            .:..|.|||..|  :|.                           |.|||.|.:|||.:.:.:.|.
plant    65 PEEELERRIMSR--NQG---------------------------REDDNIETIKKRFKVFVESTL 100

  Fly   199 PLVDYYGLRGLHFKVDAAKKSSDVFSTIDSIF 230
            |::.||..:|...|::|||.|.:||..:..:|
plant   101 PIISYYQSKGKLRKINAAKSSEEVFEAVRVLF 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 40/162 (25%)
ADK 20..222 CDD:238713 37/152 (24%)
AT3G60961NP_001118870.1 ADK <1..124 CDD:238713 37/152 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.