Sequence 1: | NP_523836.2 | Gene: | Adk2 / 37834 | FlyBaseID: | FBgn0283494 | Length: | 240 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_685909.5 | Gene: | ak9 / 557708 | ZFINID: | ZDB-GENE-041014-337 | Length: | 1762 | Species: | Danio rerio |
Alignment Length: | 251 | Identity: | 57/251 - (22%) |
---|---|---|---|
Similarity: | 111/251 - (44%) | Gaps: | 46/251 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI 86
Fly 87 DSNLDKPECKN-GFLLDGFPRTVVQAEKLDTLLDKRKT---NLDAVIEFAIDDSLLVRRITGRLI 147
Fly 148 HQASGRSY-HEEFAPPKK---------------------PMTDDVTGE-------------PLIR 177
Fly 178 RSDDNAEALKKRLEAYHKQ-TKPLVDYYGLRGLH----FKVDAAKKSSDVFSTIDS 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Adk2 | NP_523836.2 | adk | 20..233 | CDD:234711 | 57/251 (23%) |
ADK | 20..222 | CDD:238713 | 55/243 (23%) | ||
ak9 | XP_685909.5 | adk | 33..280 | CDD:273569 | 56/247 (23%) |
ADK | 33..276 | CDD:238713 | 55/243 (23%) | ||
AAA_17 | 394..504 | CDD:289950 | |||
DUF3508 | <717..804 | CDD:288841 | |||
Ribosomal_L24e_L24 | <775..808 | CDD:294589 | |||
NK | 816..>983 | CDD:302627 | |||
Adk | 1258..1445 | CDD:223637 | |||
ADK | 1258..1432 | CDD:238713 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG0563 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |