DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ak9

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:XP_685909.5 Gene:ak9 / 557708 ZFINID:ZDB-GENE-041014-337 Length:1762 Species:Danio rerio


Alignment Length:251 Identity:57/251 - (22%)
Similarity:111/251 - (44%) Gaps:46/251 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 ILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVVDMI 86
            |::|.||.||.|.|..:.:.:....:...|:|...|::.:..|.:|.:::..||.|.::::|::|
Zfish    34 IIIGKPGVGKSTLAKKIAKTWNCILIDDTDVLNNHINNETDQGKQLFRILAEGKAVPEEMMVNLI 98

  Fly    87 DSNLDKPECKN-GFLLDGFPRTVVQAEKLDTLLDKRKT---NLDAVIEFAIDDSLLVRRITGRLI 147
            ...|..|:.|: |::|...|....:..|:...:|..||   :.|.:|.....|..|:||::....
Zfish    99 VDRLKSPDIKHYGYVLACLPSISEEYMKIQEQIDLIKTLKMSPDFIINIKCADRDLIRRLSEERQ 163

  Fly   148 HQASGRSY-HEEFAPPKK---------------------PMTDDVTGE-------------PLIR 177
            |..:|..: .|::.|.||                     ..|:|:..|             .|:|
Zfish   164 HPETGCVFPKEKWDPDKKESLMKQSNMEEEEEEEEEGEEETTEDLEVEEIEEIQLQKDVIAQLVR 228

  Fly   178 RSDDNAEALKKRLEAYHKQ-TKPLVDYYGLRGLH----FKVDAAKKSSDVFSTIDS 228
            .:::..|.:..|::.|... .:||.||  :.|.:    |::|......::|.::.|
Zfish   229 VTENYPENVTSRIKCYKDNILRPLEDY--MAGHNPPYLFELDGNTDPEELFESVMS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 57/251 (23%)
ADK 20..222 CDD:238713 55/243 (23%)
ak9XP_685909.5 adk 33..280 CDD:273569 56/247 (23%)
ADK 33..276 CDD:238713 55/243 (23%)
AAA_17 394..504 CDD:289950
DUF3508 <717..804 CDD:288841
Ribosomal_L24e_L24 <775..808 CDD:294589
NK 816..>983 CDD:302627
Adk 1258..1445 CDD:223637
ADK 1258..1432 CDD:238713
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.