DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and CMPK1

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_057392.1 Gene:CMPK1 / 51727 HGNCID:18170 Length:228 Species:Homo sapiens


Alignment Length:216 Identity:66/216 - (30%)
Similarity:111/216 - (51%) Gaps:33/216 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISS-GSKLGAELKKVMDAGKLVSDDLVVDMI 86
            :||.||:|||||...:.||:...|||.|::||.|..: .|:.|..::|.:..||:|..::.:.::
Human    40 VLGGPGAGKGTQCARIVEKYGYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIVPVEITISLL 104

  Fly    87 DSNLDKPEC----KNGFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITGRLI 147
            ...:|:...    ||.||:|||||.....:..:..:| .|.::..|:.|..::.:.:.|...|  
Human   105 KREMDQTMAANAQKNKFLIDGFPRNQDNLQGWNKTMD-GKADVSFVLFFDCNNEICIERCLER-- 166

  Fly   148 HQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGLHFK 212
            .::||                         |||||.|:|:||::.|.:.|||::|.|...|...|
Human   167 GKSSG-------------------------RSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKK 206

  Fly   213 VDAAKKSSDVFSTIDSIFQRK 233
            :||:|...:||..:..||.::
Human   207 IDASKSVDEVFDEVVQIFDKE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 66/214 (31%)
ADK 20..222 CDD:238713 62/203 (31%)
CMPK1NP_057392.1 UMP_CMP_kin_fam 37..225 CDD:273576 65/212 (31%)
ADK 37..216 CDD:238713 62/203 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.