DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and AK3

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_057366.2 Gene:AK3 / 50808 HGNCID:17376 Length:227 Species:Homo sapiens


Alignment Length:225 Identity:90/225 - (40%)
Similarity:136/225 - (60%) Gaps:15/225 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 INAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKLGAELKKVMDAGKLVSDDLVV 83
            :.|:::|.|||||||.:..:...|.:.|||:||:||..:..|:::|...|..:|.|||:.||:: 
Human     8 LRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVM- 71

  Fly    84 DMIDSNLDKPECKN----GFLLDGFPRTVVQAEKLDTLLDKRKTNLDAVIEFAIDDSLLVRRITG 144
                :.|...|.||    .:||||||||:.|||.||     |...:|.||...:...::.:|:|.
Human    72 ----TRLALHELKNLTQYSWLLDGFPRTLPQAEALD-----RAYQIDTVINLNVPFEVIKQRLTA 127

  Fly   145 RLIHQASGRSYHEEFAPPKKPMTDDVTGEPLIRRSDDNAEALKKRLEAYHKQTKPLVDYYGLRGL 209
            |.||.||||.|:.||.|||....||:||||||:|.||..|.:.|||:||..||||:::||..:|:
Human   128 RWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGV 192

  Fly   210 HFKVDAAKKSSDVFSTIDSIFQRKRPAQIQ 239
             .:..:..:::.::..:.:..|.|.|.:.|
Human   193 -LETFSGTETNKIWPYVYAFLQTKVPQRSQ 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 87/216 (40%)
ADK 20..222 CDD:238713 86/205 (42%)
AK3NP_057366.2 ADK 12..190 CDD:395329 84/187 (45%)
NMP. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 37..66 11/28 (39%)
LID. /evidence=ECO:0000255|HAMAP-Rule:MF_03169, ECO:0000269|Ref.10 127..164 22/36 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53706
OrthoDB 1 1.010 - - D1004067at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.