DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Adk2 and ak7b

DIOPT Version :9

Sequence 1:NP_523836.2 Gene:Adk2 / 37834 FlyBaseID:FBgn0283494 Length:240 Species:Drosophila melanogaster
Sequence 2:NP_001103168.2 Gene:ak7b / 504040 ZFINID:ZDB-GENE-050309-170 Length:699 Species:Danio rerio


Alignment Length:215 Identity:53/215 - (24%)
Similarity:84/215 - (39%) Gaps:44/215 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAPNAAVPVERYEPEN--IGINAILLGPPGSGKGTQAPLLKEKFCVCHLSTGDMLRAEISSGSKL 63
            |..|....:|.|:...  :.|...::|||..||.|.|..:.:.:.:.|:...:.: ||.....:|
Zfish   342 MVQNIEQVIEEYKESRGLLPIRMCIVGPPAVGKSTIAEKICKHYNLHHIKLKEAI-AEALENLEL 405

  Fly    64 GAE-----------------LKKVM-DAGKLVSDDLVVDMIDSNLDKPECKN-GFLLDGFPRTVV 109
            ...                 |::.| :.|..:.|..|:.::...|....|.| ||:|||||:|..
Zfish   406 CVRTEDEENDQDDDQEFWDTLRENMNENGGRLDDQYVIRIMKDKLRTKPCMNQGFVLDGFPKTCE 470

  Fly   110 QAEKLDT-------LLDKRKTNLDAVIEFAID--DSLLVRRITGRLIHQASGRSY-HEEFAPPKK 164
            ||::|.|       |..|..|.:.....|:::  |..|..|:.........|.|| .|:|.    
Zfish   471 QAKELFTGDGEPEDLESKHATKIIPEFVFSVNATDDFLKNRVLNLPETVVEGTSYMPEQFL---- 531

  Fly   165 PMTDDVTGEPLIRRSDDNAE 184
                    :.|.|..|.|.|
Zfish   532 --------QRLARFRDRNVE 543

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Adk2NP_523836.2 adk 20..233 CDD:234711 48/194 (25%)
ADK 20..222 CDD:238713 48/194 (25%)
ak7bNP_001103168.2 WcaG <129..>286 CDD:223528
NADB_Rossmann <212..286 CDD:304358
Adk 363..583 CDD:223637 48/194 (25%)
ADK 363..556 CDD:238713 48/194 (25%)
Dpy-30 656..697 CDD:253069
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0563
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.